BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30913 (691 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 25 0.90 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 23 2.1 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 24.6 bits (51), Expect = 0.90 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 166 WTLMTGIALGASG 204 WTLM IAL ASG Sbjct: 4 WTLMAAIALAASG 16 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 23.4 bits (48), Expect = 2.1 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -3 Query: 572 QSPKAFEGYHVG*YQS*FLEVLRA--QNVRDASPG 474 + P EG+ V Q +LE LRA N R +PG Sbjct: 487 ERPNLLEGWKVEKIQEIYLEALRAYVDNRRRPNPG 521 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,947 Number of Sequences: 438 Number of extensions: 4491 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -