BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30912 (567 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 2.1 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.8 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 6.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 6.5 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 8.6 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 23.0 bits (47), Expect = 2.1 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 388 TLITNPEYSSKYLR 429 T I N YSSKY+R Sbjct: 199 TYIVNTNYSSKYMR 212 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.6 bits (46), Expect = 2.8 Identities = 8/34 (23%), Positives = 20/34 (58%) Frame = -2 Query: 152 SCRSFCTLVDTSGATHQYNIVDLSLIHLGITERL 51 SC S CT V+T ++++ ++ + + + +R+ Sbjct: 1710 SCASGCTAVETKSKPYKFHCMEKNEAAMKLKKRI 1743 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.4 bits (43), Expect = 6.5 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -3 Query: 505 PRGAGGIPVS 476 PRG GG+P S Sbjct: 399 PRGPGGVPTS 408 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 6.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 343 VTLPSPLNRLRHSPP 387 +T PSP R R++PP Sbjct: 986 MTDPSPFKRGRYTPP 1000 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.0 bits (42), Expect = 8.6 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -2 Query: 413 EYSGLVIRVGGECLSLFSGDGSVTLDECGH 324 E+ G+ +G ++L SG+ LD GH Sbjct: 174 EFGGITQCIGAFDVTLESGERVTFLDTPGH 203 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,090 Number of Sequences: 438 Number of extensions: 3486 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16440594 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -