BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30911 (651 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 25 0.84 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 23 2.6 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 23 2.6 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 2.6 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 3.4 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 3.4 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 3.4 AB264333-1|BAF44088.1| 36|Apis mellifera ecdysone-induced prot... 23 3.4 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 4.5 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 24.6 bits (51), Expect = 0.84 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 532 LLMGASLRLN*RAKKSKTGVSPILTPRPQ 618 LL+G S+R+ K+ K SP+ P P+ Sbjct: 189 LLIGPSIRITPAKKRIKLEQSPLCPPAPR 217 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 471 LPGFLIFHSFGGGPALGFTCLI 536 L G +I HS+GGG G L+ Sbjct: 656 LRGSIIDHSYGGGFGFGSAVLL 677 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 471 LPGFLIFHSFGGGPALGFTCLI 536 L G +I HS+GGG G L+ Sbjct: 694 LRGSIIDHSYGGGFGFGSAVLL 715 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +3 Query: 234 LQRDRSWKHVPRAVFVDLEPTVVDEVRTGTYRQL 335 L+ R+ H+ + D+EPTV RQL Sbjct: 234 LEERRAQSHLEAHCYFDIEPTVQQHQPVTVNRQL 267 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -3 Query: 205 RWSCLWASGHQAGCRAPGSKAPSRHYR 125 RW C W+ G C+A A SR R Sbjct: 387 RW-CTWSEGDLEKCKALTRAAYSRDVR 412 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -3 Query: 205 RWSCLWASGHQAGCRAPGSKAPSRHYR 125 RW C W+ G C+A A SR R Sbjct: 387 RW-CTWSEGDLEKCKALTRAAYSRDVR 412 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -3 Query: 205 RWSCLWASGHQAGCRAPGSKAPSRHYR 125 RW C W+ G C+A A SR R Sbjct: 387 RW-CTWSEGDLEKCKALTRAAYSRDVR 412 >AB264333-1|BAF44088.1| 36|Apis mellifera ecdysone-induced protein 75 protein. Length = 36 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 176 MARCPQTRPSGVETILSTLSSARPELE 256 +A+ P + T+ ST+SSA+PE E Sbjct: 7 VAQLPHHLSPNMPTMDSTVSSAKPEPE 33 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 4.5 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -3 Query: 517 RAGPPPKEWK 488 R PPP++WK Sbjct: 413 RTSPPPEDWK 422 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,427 Number of Sequences: 438 Number of extensions: 4895 Number of successful extensions: 11 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -