BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30909 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 25 0.69 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 25 0.69 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 25 0.69 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 25 0.69 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 25 0.69 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 25 0.69 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 25 0.69 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 25 0.69 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 25 0.91 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 24 1.2 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 24 1.2 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 24 1.2 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 24 1.2 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 24 1.2 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 24 1.2 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 24 1.2 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 24 1.2 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 24 1.2 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 24 1.2 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 24 1.2 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 24 1.2 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 24 1.2 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 24 1.2 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 24 1.2 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 24 1.2 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 24 1.2 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.8 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 6.4 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 25.0 bits (52), Expect = 0.69 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R +WL+ +E Sbjct: 28 RSRTKEERLQHRREVWLIQQERE 50 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.0 bits (52), Expect = 0.69 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R +WL+ +E Sbjct: 28 RSRTKEERLQHRREVWLIQQERE 50 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 25.0 bits (52), Expect = 0.69 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R +WL+ +E Sbjct: 28 RSRTKEERLQHRREVWLIQQERE 50 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 25.0 bits (52), Expect = 0.69 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R +WL+ +E Sbjct: 28 RSRTKEERLQHRREVWLIQQERE 50 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.0 bits (52), Expect = 0.69 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R +WL+ +E Sbjct: 28 RSRTKEERLQHRREVWLIQQERE 50 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.0 bits (52), Expect = 0.69 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R +WL+ +E Sbjct: 28 RSRTKEERLQHRREVWLIQQERE 50 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 25.0 bits (52), Expect = 0.69 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R +WL+ +E Sbjct: 28 RSRTKEERLQHRREVWLIQQERE 50 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 25.0 bits (52), Expect = 0.69 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R +WL+ +E Sbjct: 28 RSRTKEERLQHRREVWLIQQERE 50 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 24.6 bits (51), Expect = 0.91 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQEPTLNVYQRR 534 RSRT+ ER R WLV +E +R+ Sbjct: 28 RSRTKEERLQYRREAWLVQQEREQEYEKLKRK 59 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 629 RSRTERERADDGRHLWLVGDGQE 561 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 2.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 14 LYTYPENFRAYKALIAAQYXGTDVKVA 94 L+ PE+F A ALI+ Q G + VA Sbjct: 1616 LFRKPEHFVASYALISNQCEGDSLNVA 1642 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -2 Query: 468 KCDSLGNKEGACEKMSVQYF*GGQ*VRLC 382 KC++L C + SV Y G +LC Sbjct: 354 KCNTLERTPSKCSQTSVHYSNGQTHSQLC 382 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,651 Number of Sequences: 438 Number of extensions: 4914 Number of successful extensions: 29 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -