BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30906 (697 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC56F8.15 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 29 0.64 SPAC3A11.09 |sod22||plasma membrane alkali metal cation/H+ antip... 26 5.9 >SPAC56F8.15 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 176 Score = 29.1 bits (62), Expect = 0.64 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 4/58 (6%) Frame = +2 Query: 284 LCLLATQI--FELNKSIWYSIKILCFNSNSPVYLHIQVYINSHKAEYWH--SCSKHHY 445 LC L + F L + +YSI LCF S + LH+ I SH ++H + + +HY Sbjct: 18 LCTLVISVPFFFLQMTPFYSI--LCFLSFFALLLHLPCSIYSHTLHFFHHFTIACYHY 73 >SPAC3A11.09 |sod22||plasma membrane alkali metal cation/H+ antiporter Sod22|Schizosaccharomyces pombe|chr 1|||Manual Length = 759 Score = 25.8 bits (54), Expect = 5.9 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +2 Query: 368 PVYLHIQVYINSHKAEYWHSCSKHHYKENLKSPHRSE 478 P HI+ I +H+ Y S+ H +EN R E Sbjct: 634 PTLGHIESSIENHRPRYSRQNSESHLRENSVERRRRE 670 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,882,986 Number of Sequences: 5004 Number of extensions: 59724 Number of successful extensions: 117 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -