BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30906 (697 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58172| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_24078| Best HMM Match : cNMP_binding (HMM E-Value=1.4e-26) 28 8.3 >SB_58172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +1 Query: 178 DEHSRSINLASASVNSVTSRNHFERTRVLNIARLVSLL 291 DE S I L ++ VN + + FE+ + ++ R +SLL Sbjct: 50 DESSHYITLGASDVNVIWFQRPFEKREIFDVWRPISLL 87 >SB_24078| Best HMM Match : cNMP_binding (HMM E-Value=1.4e-26) Length = 692 Score = 27.9 bits (59), Expect = 8.3 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = -3 Query: 542 FAKNRKKLIFLTLTPCQIFSTPRNDEDF*DFLYNDVLNNYANIQLYGNLCK 390 F K+ LTPCQI + ++ + D+LN Y N ++Y K Sbjct: 451 FTDKEKRCTIKALTPCQIITLKKHH-------FYDILNQYPNEKVYNEKWK 494 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,447,881 Number of Sequences: 59808 Number of extensions: 408407 Number of successful extensions: 1298 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1207 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1296 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -