BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30901 (641 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83129-10|CAM84807.1| 262|Caenorhabditis elegans Hypothetical p... 28 4.9 U40419-5|AAA81426.1| 165|Caenorhabditis elegans Hypothetical pr... 27 8.6 >Z83129-10|CAM84807.1| 262|Caenorhabditis elegans Hypothetical protein W06G6.15 protein. Length = 262 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/56 (26%), Positives = 29/56 (51%) Frame = -3 Query: 213 ISFDTFLCNWFYGFKQFFTISHIISQHIRLKLA*QSPNTRIYHIYNNLNE*FTTIY 46 + + F+ WFY + FF +I Q+ LKL+ Q +H +N +++ + I+ Sbjct: 25 MEYSPFISVWFYIYIVFF----VIEQNGSLKLSHQHAAILNHHFWNGVHQVYVCIF 76 >U40419-5|AAA81426.1| 165|Caenorhabditis elegans Hypothetical protein C27F2.6 protein. Length = 165 Score = 27.5 bits (58), Expect = 8.6 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 186 WFYGFKQFFTISHIISQHI 130 WF G+ FF IS ++S HI Sbjct: 74 WFSGYCLFFLISDVLSNHI 92 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,811,281 Number of Sequences: 27780 Number of extensions: 267693 Number of successful extensions: 750 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 727 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 750 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1427403330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -