BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30901 (641 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 25 0.82 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 24 1.4 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 3.3 AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family p... 23 3.3 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 24.6 bits (51), Expect = 0.82 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = +3 Query: 363 WFTGLDWLGRGPRPLHPAINTAVHQRRSSRLF 458 WF G +W G R L P I V + F Sbjct: 625 WFDGFNWEGLRARTLEPPIMPRVQNATDTTNF 656 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.8 bits (49), Expect = 1.4 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 355 QGRGLLDWIGLGEDQD 402 +G G+ WIG G D D Sbjct: 478 KGNGVYAWIGAGRDSD 493 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 636 DKGASPSPNPRFEAA 592 + +SPSPNPR +A Sbjct: 506 ETNSSPSPNPRIASA 520 >AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family protein protein. Length = 166 Score = 22.6 bits (46), Expect = 3.3 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 406 RGLGPRPSQSSPVNHDPEPEEIFHYLLRN 320 R +G S++ + HDP + YL+R+ Sbjct: 40 RCMGGINSRNMDIEHDPGLAAVLQYLIRS 68 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,258 Number of Sequences: 438 Number of extensions: 3130 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19315974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -