BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30901 (641 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g58140.1 68416.m06483 phenylalanyl-tRNA synthetase class IIc ... 31 0.86 At3g25440.1 68416.m03163 group II intron splicing factor CRS1-re... 29 3.5 At4g32780.1 68417.m04663 expressed protein 28 6.1 At3g42080.1 68416.m04318 hypothetical protein hypothetical prote... 28 6.1 >At3g58140.1 68416.m06483 phenylalanyl-tRNA synthetase class IIc family protein similar to phenylalanine-tRNA synthetase [Homo sapiens] GI:3983103; contains Pfam profile PF01409: tRNA synthetases class II core domain (F) Length = 429 Score = 30.7 bits (66), Expect = 0.86 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = +1 Query: 373 DWIGLGEDQDPYIQQSTQQCINGDLADCFKAQALRSFDDFFDKQASNFQI 522 DW G G+D Y + ++C+ G F + +R D +F +F++ Sbjct: 210 DWNGSGKDSTLYAAEDLKKCLEGLARHLFGSVEMRWVDTYFPFTNPSFEL 259 >At3g25440.1 68416.m03163 group II intron splicing factor CRS1-related contains weak similarity to CRS1 [Zea mays] gi|9837550|gb|AAG00595 Length = 380 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/23 (56%), Positives = 16/23 (69%), Gaps = 3/23 (13%) Frame = -2 Query: 388 PSQSSPVNHDPE---PEEIFHYL 329 PS+S+ HDPE PEE F+YL Sbjct: 100 PSESAETTHDPEILTPEEHFYYL 122 >At4g32780.1 68417.m04663 expressed protein Length = 224 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +3 Query: 267 ASDYQTSLPKKTPKKITQFRRR*WKISS 350 A + +T+LP +TP ++ +F R W IS+ Sbjct: 45 AREVRTALPPETPTEMMEFLGRSWSISA 72 >At3g42080.1 68416.m04318 hypothetical protein hypothetical proteins - Arabidopsis thaliana Length = 161 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 284 QPSKENTEEDHSISEEIMEDLLRLRVVVYWTG 379 QP+ +TEE+H I + + ++LL +WTG Sbjct: 62 QPTNPSTEEEHLIFDSVAKELLE-----FWTG 88 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,105,305 Number of Sequences: 28952 Number of extensions: 255737 Number of successful extensions: 750 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 722 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 749 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -