BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30900 (708 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. 25 1.8 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 25 3.1 >AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. Length = 603 Score = 25.4 bits (53), Expect = 1.8 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +1 Query: 526 DVDIITGDILKTDLSQFIPSDAKVHWLDSTFHQFTSLGNL 645 DVD++ GD+LK +Q + ++ ++ HQ+ S+ N+ Sbjct: 496 DVDMLFGDLLKNKGAQNYKTPRQI--AENELHQYLSVENI 533 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 24.6 bits (51), Expect = 3.1 Identities = 12/42 (28%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +3 Query: 15 NSLYEINRREKSRTRSKITSDFETQSTDG-LHDRSRSVGCLL 137 N Y + ++ + T+DF ++TDG H+ + CLL Sbjct: 1276 NCKYNTTQHHQTHHERRTTADFGRKATDGRQHEYAVPSNCLL 1317 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 763,707 Number of Sequences: 2352 Number of extensions: 16569 Number of successful extensions: 70 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72340815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -