BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30900 (708 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF151833-1|AAD34070.1| 346|Homo sapiens CGI-75 protein protein. 107 4e-23 BC017788-1|AAH17788.1| 346|Homo sapiens transcription factor B1... 107 5e-23 BC005183-1|AAH05183.1| 341|Homo sapiens Unknown (protein for IM... 107 5e-23 AL139101-2|CAI20506.1| 346|Homo sapiens transcription factor B1... 107 5e-23 BC010874-1|AAH10874.1| 313|Homo sapiens DIM1 dimethyladenosine ... 42 0.002 BC002841-1|AAH02841.1| 275|Homo sapiens DIMT1L protein protein. 42 0.002 AF102147-1|AAC97955.1| 313|Homo sapiens putative dimethyladenos... 42 0.002 BC002698-1|AAH02698.1| 106|Homo sapiens coiled-coil domain cont... 41 0.004 >AF151833-1|AAD34070.1| 346|Homo sapiens CGI-75 protein protein. Length = 346 Score = 107 bits (257), Expect = 4e-23 Identities = 49/91 (53%), Positives = 70/91 (76%) Frame = +2 Query: 236 TDKAASIPSIKDVIKLYKLRALRELSQNFLMEPRLIDKIVRASGNIQNHTVCEVGPGPGG 415 T + +P+I+++IKL +L+A ELSQNFL++ RL DKIVR +GN+ N V EVGPGPGG Sbjct: 9 TCRLPPLPTIREIIKLLRLQAANELSQNFLLDLRLTDKIVRKAGNLTNAYVYEVGPGPGG 68 Query: 416 ITRSIIRQAPKKLVLIEKDPRFLPSLELLAD 508 ITRSI+ +L+++EKD RF+P L++L+D Sbjct: 69 ITRSILNADVAELLVVEKDTRFIPGLQMLSD 99 >BC017788-1|AAH17788.1| 346|Homo sapiens transcription factor B1, mitochondrial protein. Length = 346 Score = 107 bits (256), Expect = 5e-23 Identities = 48/91 (52%), Positives = 71/91 (78%) Frame = +2 Query: 236 TDKAASIPSIKDVIKLYKLRALRELSQNFLMEPRLIDKIVRASGNIQNHTVCEVGPGPGG 415 T + +P+I+++IKL +L+A ++LSQNFL++ RL DKIVR +GN+ N V EVGPGPGG Sbjct: 9 TCRLPPLPTIREIIKLLRLQAAKQLSQNFLLDLRLTDKIVRKAGNLTNAYVYEVGPGPGG 68 Query: 416 ITRSIIRQAPKKLVLIEKDPRFLPSLELLAD 508 ITRSI+ +L+++EKD RF+P L++L+D Sbjct: 69 ITRSILNADVAELLVVEKDTRFIPGLQMLSD 99 >BC005183-1|AAH05183.1| 341|Homo sapiens Unknown (protein for IMAGE:4041141) protein. Length = 341 Score = 107 bits (256), Expect = 5e-23 Identities = 48/91 (52%), Positives = 71/91 (78%) Frame = +2 Query: 236 TDKAASIPSIKDVIKLYKLRALRELSQNFLMEPRLIDKIVRASGNIQNHTVCEVGPGPGG 415 T + +P+I+++IKL +L+A ++LSQNFL++ RL DKIVR +GN+ N V EVGPGPGG Sbjct: 9 TCRLPPLPTIREIIKLLRLQAAKQLSQNFLLDLRLTDKIVRKAGNLTNAYVYEVGPGPGG 68 Query: 416 ITRSIIRQAPKKLVLIEKDPRFLPSLELLAD 508 ITRSI+ +L+++EKD RF+P L++L+D Sbjct: 69 ITRSILNADVAELLVVEKDTRFIPGLQMLSD 99 >AL139101-2|CAI20506.1| 346|Homo sapiens transcription factor B1, mitochondrial protein. Length = 346 Score = 107 bits (256), Expect = 5e-23 Identities = 48/91 (52%), Positives = 71/91 (78%) Frame = +2 Query: 236 TDKAASIPSIKDVIKLYKLRALRELSQNFLMEPRLIDKIVRASGNIQNHTVCEVGPGPGG 415 T + +P+I+++IKL +L+A ++LSQNFL++ RL DKIVR +GN+ N V EVGPGPGG Sbjct: 9 TCRLPPLPTIREIIKLLRLQAAKQLSQNFLLDLRLTDKIVRKAGNLTNAYVYEVGPGPGG 68 Query: 416 ITRSIIRQAPKKLVLIEKDPRFLPSLELLAD 508 ITRSI+ +L+++EKD RF+P L++L+D Sbjct: 69 ITRSILNADVAELLVVEKDTRFIPGLQMLSD 99 >BC010874-1|AAH10874.1| 313|Homo sapiens DIM1 dimethyladenosine transferase 1-like (S. cerevisiae) protein. Length = 313 Score = 42.3 bits (95), Expect = 0.002 Identities = 22/62 (35%), Positives = 34/62 (54%) Frame = +2 Query: 308 LSQNFLMEPRLIDKIVRASGNIQNHTVCEVGPGPGGITRSIIRQAPKKLVLIEKDPRFLP 487 + Q+ L P +I+ I+ + V EVGPG G +T ++ +A KK+V E DPR + Sbjct: 34 IGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKA-KKVVACELDPRLVA 92 Query: 488 SL 493 L Sbjct: 93 EL 94 >BC002841-1|AAH02841.1| 275|Homo sapiens DIMT1L protein protein. Length = 275 Score = 42.3 bits (95), Expect = 0.002 Identities = 22/62 (35%), Positives = 34/62 (54%) Frame = +2 Query: 308 LSQNFLMEPRLIDKIVRASGNIQNHTVCEVGPGPGGITRSIIRQAPKKLVLIEKDPRFLP 487 + Q+ L P +I+ I+ + V EVGPG G +T ++ +A KK+V E DPR + Sbjct: 34 IGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKA-KKVVACELDPRLVA 92 Query: 488 SL 493 L Sbjct: 93 EL 94 >AF102147-1|AAC97955.1| 313|Homo sapiens putative dimethyladenosine transferase protein. Length = 313 Score = 42.3 bits (95), Expect = 0.002 Identities = 22/62 (35%), Positives = 34/62 (54%) Frame = +2 Query: 308 LSQNFLMEPRLIDKIVRASGNIQNHTVCEVGPGPGGITRSIIRQAPKKLVLIEKDPRFLP 487 + Q+ L P +I+ I+ + V EVGPG G +T ++ +A KK+V E DPR + Sbjct: 34 IGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKA-KKVVACELDPRLVA 92 Query: 488 SL 493 L Sbjct: 93 EL 94 >BC002698-1|AAH02698.1| 106|Homo sapiens coiled-coil domain containing 56 protein. Length = 106 Score = 41.1 bits (92), Expect = 0.004 Identities = 18/38 (47%), Positives = 26/38 (68%) Frame = +1 Query: 85 RNRLTGFTIGAGVLGVYLYSIFAIKQETFLDDFDEPPK 198 RN +TG IGA VL +Y Y+ ++I QE FLD+ ++ K Sbjct: 56 RNIVTGLGIGALVLAIYGYTFYSISQERFLDELEDEAK 93 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,609,782 Number of Sequences: 237096 Number of extensions: 2209071 Number of successful extensions: 5184 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 5036 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5184 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8231208258 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -