BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30899 (390 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 2.5 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 20 10.0 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 20 10.0 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 21.8 bits (44), Expect = 2.5 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 158 FWPQSRLDLKRAM 196 FW QS LDL R + Sbjct: 450 FWQQSDLDLSRGL 462 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 19.8 bits (39), Expect = 10.0 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +1 Query: 22 YNQFHSHVFQGIKFCDIF*DKLPSCLG*IYYSAL 123 Y+ + VF ++ F L SCL +YY L Sbjct: 151 YSTYGIQVFGTMQRTSFFKTFLNSCLMDVYYEFL 184 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 19.8 bits (39), Expect = 10.0 Identities = 5/16 (31%), Positives = 10/16 (62%) Frame = -2 Query: 278 WLMFMSVTVCNTMLWD 231 WL F++ + N + W+ Sbjct: 243 WLFFLANFLTNLLFWE 258 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,312 Number of Sequences: 336 Number of extensions: 1401 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8225022 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -