BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30895 (749 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC56F8.11 |spc3||signal peptidase subunit Spc3 |Schizosaccharo... 58 2e-09 SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||... 30 0.40 SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple... 28 1.2 SPAC15A10.08 |ain1||alpha-actinin|Schizosaccharomyces pombe|chr ... 27 3.8 SPAC688.06c |slx4||structure-specific endonuclease subunit |Schi... 26 6.6 SPAC1093.05 |||ATP-dependent RNA helicase Hca4 |Schizosaccharomy... 26 6.6 >SPAC56F8.11 |spc3||signal peptidase subunit Spc3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 185 Score = 57.6 bits (133), Expect = 2e-09 Identities = 28/70 (40%), Positives = 41/70 (58%), Gaps = 1/70 (1%) Frame = +1 Query: 256 YGASRE-RNDLGFLTFDLKTDLSNLFNWNVKQLFLYLTAEYITPSNELNQVVLWDKIILR 432 Y A R R + F++ DLS L++WN K + +YL A Y T +E NQVV+WDKI+ Sbjct: 58 YHAFRNVRQQYAQVKFNMDADLSELWDWNTKHVVVYLVASYSTEKHEKNQVVVWDKILSS 117 Query: 433 GENAVLDFKN 462 E + + K+ Sbjct: 118 PEESKMFMKD 127 >SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1367 Score = 29.9 bits (64), Expect = 0.40 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +3 Query: 528 TLSWNIIP--NAGLLTQHPGSWSTLLQVSYRIYFKQEYDLRNSRISAAWPT 674 TL+W ++ NA L +H G W L + Y L+NS IS+ T Sbjct: 212 TLTWKLVGFNNANALGEHIGLWRKLKKFISHTVADMSYCLKNSGISSGLAT 262 >SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1522 Score = 28.3 bits (60), Expect = 1.2 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 483 LGRWQRLKSHSNVTLTLSWNIIPNAGLLTQHPGS 584 LG+ RL+ +SNV + + + +G + HPG+ Sbjct: 10 LGQCHRLEDYSNVAINYTGPYLTPSGTMAYHPGN 43 >SPAC15A10.08 |ain1||alpha-actinin|Schizosaccharomyces pombe|chr 1|||Manual Length = 621 Score = 26.6 bits (56), Expect = 3.8 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +3 Query: 447 ARLQEHEH*VLFLGRWQRLKSHSN 518 AR+QE+ H V F + +KSHSN Sbjct: 271 ARMQEYWHTVQFENNYTDVKSHSN 294 >SPAC688.06c |slx4||structure-specific endonuclease subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 419 Score = 25.8 bits (54), Expect = 6.6 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 260 EHLGNEMILAS*LSILKQICPISLTGTLNSCSYISLPNTLHQ 385 E LGN+ I A+ ++K++C S T N C +S + + Q Sbjct: 171 EKLGNKSIEANRSPLIKELCE-SANSTENVCFSVSTVDEIQQ 211 >SPAC1093.05 |||ATP-dependent RNA helicase Hca4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 735 Score = 25.8 bits (54), Expect = 6.6 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 436 ENAVLDFKNMNTKYYFWDDGNGLKVTAMS 522 + A+L +K K YF D+GN + AM+ Sbjct: 584 KKAMLKYKKSADKVYFDDEGNAIPFYAMN 612 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,940,836 Number of Sequences: 5004 Number of extensions: 60169 Number of successful extensions: 128 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 128 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 357280532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -