BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30893 (669 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 25 0.86 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 23 3.5 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 23 3.5 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 23 3.5 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 23 3.5 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 24.6 bits (51), Expect = 0.86 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 35 GWITIHQWDVLVIMLVFWNLV 97 GWI H+W + M+ F NLV Sbjct: 377 GWICEHRWRQIYNMVRFRNLV 397 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 22.6 bits (46), Expect = 3.5 Identities = 13/50 (26%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +1 Query: 82 VLESGTIETTSLAQYDRIMNTNVRGPYYLTMLAIPHLIKT--KGNIVNVS 225 VL+SG + T ++ ++ L + IPH + T KG +V+++ Sbjct: 142 VLDSGLVNNTQPMCSPKLFAFDLNTSQLLKQVEIPHDVATTGKGELVSLT 191 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/41 (24%), Positives = 19/41 (46%) Frame = +1 Query: 67 CNNAGVLESGTIETTSLAQYDRIMNTNVRGPYYLTMLAIPH 189 C+ VL+SG + T +++ ++ L + IPH Sbjct: 132 CDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPH 172 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/41 (24%), Positives = 19/41 (46%) Frame = +1 Query: 67 CNNAGVLESGTIETTSLAQYDRIMNTNVRGPYYLTMLAIPH 189 C+ VL+SG + T +++ ++ L + IPH Sbjct: 132 CDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPH 172 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/41 (24%), Positives = 19/41 (46%) Frame = +1 Query: 67 CNNAGVLESGTIETTSLAQYDRIMNTNVRGPYYLTMLAIPH 189 C+ VL+SG + T +++ ++ L + IPH Sbjct: 132 CDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPH 172 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,598 Number of Sequences: 438 Number of extensions: 4068 Number of successful extensions: 15 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -