BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30891 (692 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0136 - 992662-992821,992879-993051 29 4.6 11_01_0676 - 5511755-5511831,5512857-5513052,5513462-5513577,551... 28 6.1 10_01_0097 - 1171949-1172047,1172520-1172591,1172791-1172949,117... 28 6.1 >07_01_0136 - 992662-992821,992879-993051 Length = 110 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -3 Query: 375 RTFILLVIWNKFERIEKRN*KAIRNILMNEHTGT 274 R +LL+ W KF ++ N K + N L N+HT + Sbjct: 58 RILLLLLQWLKFFNLKHTNSKLLPNPLPNKHTSS 91 >11_01_0676 - 5511755-5511831,5512857-5513052,5513462-5513577, 5513752-5514597,5515515-5515766,5522344-5525206 Length = 1449 Score = 28.3 bits (60), Expect = 6.1 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 592 RELNGFPIPNNPLHGPCPGLLMN 524 R + G +P+ PLHGP LL N Sbjct: 83 RRVTGLSLPHTPLHGPITPLLGN 105 >10_01_0097 - 1171949-1172047,1172520-1172591,1172791-1172949, 1172998-1173381,1173478-1175253,1175329-1175452, 1176859-1177027,1177131-1177226,1177339-1177527, 1177965-1179303 Length = 1468 Score = 28.3 bits (60), Expect = 6.1 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +3 Query: 537 PGQGPWRGLFGIGKPLSSLRGETKNSLNRFPANRG*RLRPPWTIKMVTGPGG 692 P G +R L +G+P R + R P + R PWT+ + G GG Sbjct: 1320 PRNGSYRNLDDLGRPGDRSRDNLPFGMPRRPNSSNGSRREPWTV--LDGQGG 1369 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,886,644 Number of Sequences: 37544 Number of extensions: 424428 Number of successful extensions: 663 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 647 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 662 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -