BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30890 (740 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 28 0.35 AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14... 24 4.3 AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 24 5.7 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 23 9.9 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 23 9.9 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 27.9 bits (59), Expect = 0.35 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +1 Query: 523 TKLLTFPAIGYASP*HK-CTPAFPMPTPAIVAPDACSISLP 642 TK++ PA+ YA+P K + A P+ T VA A S + P Sbjct: 97 TKVIAQPAVAYAAPVAKTISYAAPVATKTYVAQPALSYAAP 137 >AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14D protein. Length = 360 Score = 24.2 bits (50), Expect = 4.3 Identities = 10/55 (18%), Positives = 23/55 (41%) Frame = +1 Query: 571 KCTPAFPMPTPAIVAPDACSISLPRLQKLFTERTKILCKGLQTKSRPKHSDNGDC 735 +C P + + PD L+ +T + C G+++K + ++ +C Sbjct: 46 ECQPLVDIYNKPVNTPDDTQFLTESRCGLYERKTLVCCAGVRSKGKTSLPESPNC 100 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 23.8 bits (49), Expect = 5.7 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -3 Query: 696 LQTLAKYFRSFSEQFLETWKRDR 628 LQ KYFR SE E W +R Sbjct: 422 LQRSEKYFRRASEYLPERWLSER 444 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.0 bits (47), Expect = 9.9 Identities = 9/36 (25%), Positives = 20/36 (55%) Frame = +1 Query: 118 YQIQFTLTYIETISKWSMIPPAILINPLQIVSLERF 225 Y+I +T+T +E + +W + +++LE+F Sbjct: 241 YKIFYTMTAVEDLDEWQTKVVGV-TESADLINLEKF 275 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 23.0 bits (47), Expect = 9.9 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +1 Query: 76 YILLTRMMFHLSNHYQI 126 + +L R MFH+ N Y+I Sbjct: 866 FAVLERSMFHIQNAYRI 882 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 706,996 Number of Sequences: 2352 Number of extensions: 13859 Number of successful extensions: 36 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76091949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -