BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30887 (726 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16673| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_37295| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 >SB_16673| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 529 Score = 27.9 bits (59), Expect = 8.9 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +3 Query: 117 YPNSTISYTLYSCRL*SDSMRRMILNNIVVS-ATSYIAATYSWLRLTNVLRSYRSRTI 287 YP I +T Y+ +L +D R+M +V+S AT YS L + R ++ T+ Sbjct: 155 YPTPQIIWTRYNGKLSADRTRKMPNGTLVISKATRGDGGAYSCLVTNELGRDLKNFTV 212 >SB_37295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 620 Score = 27.9 bits (59), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 621 GTCGIYHLKRTWFRWYDVTGRVKNSG 698 GTCG +LK F W +G+ +SG Sbjct: 299 GTCGFINLKNDKFDWTRQSGKTPSSG 324 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,969,528 Number of Sequences: 59808 Number of extensions: 340593 Number of successful extensions: 743 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 690 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 742 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -