BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30887 (726 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein ... 25 1.8 CR954257-5|CAJ14156.1| 227|Anopheles gambiae predicted protein ... 24 5.5 >CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein protein. Length = 196 Score = 25.4 bits (53), Expect = 1.8 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -2 Query: 674 YIVPSKPSAF*VVNTTRSRSPRFFRNKCATNLISMP 567 + P++ SA R+R+P F +CA N I P Sbjct: 43 FAYPAEQSAIESKQNARNRTPIFIPKQCAENEILYP 78 >CR954257-5|CAJ14156.1| 227|Anopheles gambiae predicted protein protein. Length = 227 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 638 VNTTRSRSPRFFRNKCATNLISMP 567 + R+R+P + KC+TN I P Sbjct: 50 LENARNRTPVYIPGKCSTNEILYP 73 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 655,369 Number of Sequences: 2352 Number of extensions: 11486 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -