BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30887 (726 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U21308-11|AAB93312.3| 265|Caenorhabditis elegans Roller: helica... 31 0.63 U21308-10|AAN65281.1| 329|Caenorhabditis elegans Roller: helica... 31 0.63 M25477-1|AAA27991.1| 329|Caenorhabditis elegans collagen protein. 31 0.63 >U21308-11|AAB93312.3| 265|Caenorhabditis elegans Roller: helically twisted, animalsroll when moving protein 8, isoform b protein. Length = 265 Score = 31.5 bits (68), Expect = 0.63 Identities = 15/45 (33%), Positives = 27/45 (60%) Frame = +3 Query: 174 MRRMILNNIVVSATSYIAATYSWLRLTNVLRSYRSRTIIKTIQCK 308 MRR+ +VVS + IA+ + L N ++S++S +++T CK Sbjct: 12 MRRIAFVAVVVSTAAVIASVVTLPMLYNYVQSFQSHLMVETDYCK 56 >U21308-10|AAN65281.1| 329|Caenorhabditis elegans Roller: helically twisted, animalsroll when moving protein 8, isoform a protein. Length = 329 Score = 31.5 bits (68), Expect = 0.63 Identities = 15/45 (33%), Positives = 27/45 (60%) Frame = +3 Query: 174 MRRMILNNIVVSATSYIAATYSWLRLTNVLRSYRSRTIIKTIQCK 308 MRR+ +VVS + IA+ + L N ++S++S +++T CK Sbjct: 12 MRRIAFVAVVVSTAAVIASVVTLPMLYNYVQSFQSHLMVETDYCK 56 >M25477-1|AAA27991.1| 329|Caenorhabditis elegans collagen protein. Length = 329 Score = 31.5 bits (68), Expect = 0.63 Identities = 15/45 (33%), Positives = 27/45 (60%) Frame = +3 Query: 174 MRRMILNNIVVSATSYIAATYSWLRLTNVLRSYRSRTIIKTIQCK 308 MRR+ +VVS + IA+ + L N ++S++S +++T CK Sbjct: 12 MRRIAFVAVVVSTAAVIASVVTLPMLYNYVQSFQSHLMVETDYCK 56 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,334,421 Number of Sequences: 27780 Number of extensions: 260908 Number of successful extensions: 599 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 592 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 599 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1708383636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -