BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30883 (573 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY062198-1|AAL58559.1| 153|Anopheles gambiae cytochrome P450 CY... 26 1.0 AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 23 9.3 >AY062198-1|AAL58559.1| 153|Anopheles gambiae cytochrome P450 CYP4J5 protein. Length = 153 Score = 25.8 bits (54), Expect = 1.0 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -1 Query: 501 VYHLEVFPVRSPDPMILS-SRFLYKCMRIFLEYAYVP 394 ++ L P + PDP RFL +C+ YAY+P Sbjct: 106 IFDLHRDPAQFPDPERFDPDRFLPECVSQRSPYAYIP 142 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 22.6 bits (46), Expect = 9.3 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +2 Query: 134 SINCSKRYGMYTATL 178 S NC++RYG + AT+ Sbjct: 398 SPNCNQRYGWHPATV 412 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 681,165 Number of Sequences: 2352 Number of extensions: 15914 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54245403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -