BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30882 (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 36 2e-04 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 24 1.4 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 4.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 4.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 4.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 4.2 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 7.3 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 21 7.3 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 21 7.3 AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory recept... 21 7.3 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 36.3 bits (80), Expect = 2e-04 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +3 Query: 534 LFGTG-NTGINFSKYEDIPVEASGDRVPDCITSFEDVNLTELIAGQILSLARYDKP 698 LF +G TG+NF K ++I V+ +G+ P ITSFE L + + + Y KP Sbjct: 127 LFTSGITTGVNFMKLDEIEVKVTGNDAPPPITSFETSGLRPHLLENV-KKSGYTKP 181 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 23.8 bits (49), Expect = 1.4 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 5/78 (6%) Frame = -1 Query: 476 RDLVRRTSSEGQRELERS-SALGSGSFQRSFRGALVH----NPPHVARREARVGPVRVHD 312 ++L+R+T ++ S S+ S Q H NP + + P ++ Sbjct: 241 KELIRQTHKSPSHSVDNSNSSEKKSSIQHGDDAHKTHHLDKNPENTLGTMLSIHPSKLDV 300 Query: 311 HSISRIHSNALVRHSEIH 258 ++ +HSN L H + H Sbjct: 301 EQMNLLHSNDLNMHQQHH 318 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 315 VNANGTDAGLATCDVRRIMNQXT 383 +NANGT+AG R M + T Sbjct: 1445 LNANGTNAGTPVLSRRLTMRRET 1467 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 315 VNANGTDAGLATCDVRRIMNQXT 383 +NANGT+AG R M + T Sbjct: 1445 LNANGTNAGTPVLSRRLTMRRET 1467 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 315 VNANGTDAGLATCDVRRIMNQXT 383 +NANGT+AG R M + T Sbjct: 1445 LNANGTNAGTPVLSRRLTMRRET 1467 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 315 VNANGTDAGLATCDVRRIMNQXT 383 +NANGT+AG R M + T Sbjct: 1445 LNANGTNAGTPVLSRRLTMRRET 1467 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -1 Query: 650 CQVNILKTGDAVWYAVSAGFNRY 582 CQ + GDAV Y + G++ + Sbjct: 473 CQYCNIAFGDAVLYTIHMGYHGF 495 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -1 Query: 389 FRGALVHNPPHVA 351 F A+ H PPH A Sbjct: 207 FLAAMAHRPPHFA 219 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 21.4 bits (43), Expect = 7.3 Identities = 6/25 (24%), Positives = 14/25 (56%) Frame = -2 Query: 343 RPASVPFAFTIIPFLGFIPTLWFAI 269 RP+S+ F I+ ++P + + + Sbjct: 313 RPSSLRFCLNILSIFTYVPMILYCV 337 >AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory receptor candidate 24 protein. Length = 384 Score = 21.4 bits (43), Expect = 7.3 Identities = 6/25 (24%), Positives = 14/25 (56%) Frame = -2 Query: 343 RPASVPFAFTIIPFLGFIPTLWFAI 269 RP+S+ F I+ ++P + + + Sbjct: 38 RPSSLRFCLNILSIFTYVPMILYCV 62 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,729 Number of Sequences: 336 Number of extensions: 3605 Number of successful extensions: 12 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -