BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30879 (565 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 3.2 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 22 3.2 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 22 4.2 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 22 4.2 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 21 5.5 DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 21 9.6 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.2 bits (45), Expect = 3.2 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -2 Query: 450 SWIVQFEGPQEITRVLELFSNSE 382 SW+ F+G ITR + + S+ Sbjct: 915 SWVAPFDGNSPITRYMIEYKQSK 937 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 22.2 bits (45), Expect = 3.2 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 86 PWYQPSFTEVRKVLQLFRLRQINNG 160 P QP+ R + R++Q+NNG Sbjct: 80 PQQQPASVARRNARERNRVKQVNNG 104 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 21.8 bits (44), Expect = 4.2 Identities = 10/39 (25%), Positives = 21/39 (53%) Frame = +2 Query: 443 IQLVVGARRPFIMSTGETLVTARQDQRSSQEDGLNK*IY 559 I +VV + ++S GET + + + + +DG + +Y Sbjct: 166 IDVVVPITQFTLLSIGETAMGIKLNASDNDKDGYKRAVY 204 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 21.8 bits (44), Expect = 4.2 Identities = 10/39 (25%), Positives = 21/39 (53%) Frame = +2 Query: 443 IQLVVGARRPFIMSTGETLVTARQDQRSSQEDGLNK*IY 559 I +VV + ++S GET + + + + +DG + +Y Sbjct: 166 IDVVVPITQFTLLSIGETAMGIKLNASDNDKDGYKRAVY 204 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 21.4 bits (43), Expect = 5.5 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +2 Query: 431 SN*TIQLVVGARRPFIMSTGETLVTARQDQ 520 +N T VVG R P++ G T ++Q Sbjct: 290 ANLTDNSVVGVRAPYLRVGGNNQFTMMEEQ 319 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 20.6 bits (41), Expect = 9.6 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +1 Query: 16 PDKHAIVATTTFPGKP 63 P KH + T PG+P Sbjct: 267 PSKHGLNDATAAPGEP 282 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,472 Number of Sequences: 336 Number of extensions: 3677 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13890653 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -