BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30871 (729 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_8792| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_59749| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_31470| Best HMM Match : SAND (HMM E-Value=5e-37) 29 3.9 SB_7441| Best HMM Match : Collagen (HMM E-Value=0.05) 29 3.9 SB_3524| Best HMM Match : ETS_PEA3_N (HMM E-Value=5.8) 29 3.9 SB_56934| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_31262| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_47423| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_4689| Best HMM Match : Dicty_CTDC (HMM E-Value=5.8) 29 5.1 SB_33252| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_6496| Best HMM Match : Collagen (HMM E-Value=0) 28 6.7 SB_33716| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_26017| Best HMM Match : Extensin_2 (HMM E-Value=0.11) 28 6.7 SB_52295| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_39538| Best HMM Match : VWA (HMM E-Value=0) 28 8.9 SB_22107| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_21683| Best HMM Match : Fe_dep_repress (HMM E-Value=4) 28 8.9 SB_9550| Best HMM Match : GPS (HMM E-Value=1.6e-11) 28 8.9 SB_10537| Best HMM Match : CTP_transf_2 (HMM E-Value=0) 28 8.9 >SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTPGESAHVVQLL 259 P S PSTP TP PSTP H+V L+ Sbjct: 548 PSMPSTPSTPSTPSTPSTPSTPSTLVHLVHLV 579 Score = 33.1 bits (72), Expect = 0.24 Identities = 28/89 (31%), Positives = 36/89 (40%), Gaps = 13/89 (14%) Frame = +2 Query: 2 PLMPSVTNGESSMCESRYRSPVSPATNP----FSINDFEFEPWASSL---------LGEM 142 P PS S+ C +P +P+TN S +F FE W+ L ++ Sbjct: 318 PSTPSTPKTPSTPC-----TPNTPSTNRKKIFISALEFAFETWSMERVHFLKIDIDLVDI 372 Query: 143 SNEDSKEPKDGSVEGPPSTPLTPRAPSTP 229 P S PSTP TPR PSTP Sbjct: 373 ITSTPSTPCTPSTPSTPSTPSTPRTPSTP 401 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTPG 232 P S PSTP TP AP TPG Sbjct: 491 PSTSSTPSTPSTPSTPSAPGTPG 513 Score = 31.9 bits (69), Expect = 0.55 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTPGESAHVVQLL 259 P S+ PSTP TP PSTP + +V L+ Sbjct: 545 PSTPSMPSTPSTPSTPSTPSTPSTPSTLVHLV 576 Score = 31.5 bits (68), Expect = 0.72 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S PSTP+TPR PSTP Sbjct: 404 PCTPSTPSTPSTPITPRTPSTP 425 Score = 31.1 bits (67), Expect = 0.96 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S G PSTP TP PSTP Sbjct: 518 PSTPSAPGTPSTPSTPSTPSTP 539 Score = 30.7 bits (66), Expect = 1.3 Identities = 21/76 (27%), Positives = 28/76 (36%) Frame = +2 Query: 2 PLMPSVTNGESSMCESRYRSPVSPATNPFSINDFEFEPWASSLLGEMSNEDSKEPKDGSV 181 P PS + S+ C S S + P + + S+ + P S Sbjct: 66 PSAPSTPSTPSTPCTPSTPSTPSTPSTPSTPSTPSAPSTPSTPSTPSTPSTPSTPSTPST 125 Query: 182 EGPPSTPLTPRAPSTP 229 PSTP TP PSTP Sbjct: 126 PSAPSTPSTPSTPSTP 141 Score = 30.7 bits (66), Expect = 1.3 Identities = 24/76 (31%), Positives = 32/76 (42%) Frame = +2 Query: 2 PLMPSVTNGESSMCESRYRSPVSPATNPFSINDFEFEPWASSLLGEMSNEDSKEPKDGSV 181 P PS + S+ C +P +P+T S+ P S S + P S Sbjct: 261 PSTPSTPSTPSTPCTPN--TPSTPSTP--SMPSTPSTPSTPSTPSTPSTPSA--PSTPST 314 Query: 182 EGPPSTPLTPRAPSTP 229 PSTP TP+ PSTP Sbjct: 315 PSTPSTPSTPKTPSTP 330 Score = 30.7 bits (66), Expect = 1.3 Identities = 25/80 (31%), Positives = 33/80 (41%), Gaps = 3/80 (3%) Frame = +2 Query: 2 PLMPSVTNGESS-MCESRYRSPVSPAT-NPFSINDFEFEPWASSLLGEMSNEDSKE-PKD 172 P PS+T+ S+ S +P +P+T + S P S S + P Sbjct: 446 PSTPSLTHTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTPSTSSTPSTPSTPST 505 Query: 173 GSVEGPPSTPLTPRAPSTPG 232 S G P TP TP PS PG Sbjct: 506 PSAPGTPGTPSTPSTPSAPG 525 Score = 30.7 bits (66), Expect = 1.3 Identities = 24/76 (31%), Positives = 32/76 (42%) Frame = +2 Query: 2 PLMPSVTNGESSMCESRYRSPVSPATNPFSINDFEFEPWASSLLGEMSNEDSKEPKDGSV 181 P PS + S+ C +P +P+T S+ P S S + P S Sbjct: 811 PSTPSTPSTPSTPCTPN--TPSTPSTP--SMPSTPSTPSTPSTPSTPSTPSA--PSTPST 864 Query: 182 EGPPSTPLTPRAPSTP 229 PSTP TP+ PSTP Sbjct: 865 PSTPSTPSTPKTPSTP 880 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTPGESA 241 P S PSTP TP PSTP S+ Sbjct: 470 PSTPSTPSTPSTPSTPSTPSTPSTSS 495 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S PSTP TPR PSTP Sbjct: 15 PCTPSTPSTPSTPSTPRTPSTP 36 Score = 29.9 bits (64), Expect = 2.2 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S PSTP+TP PSTP Sbjct: 150 PSTPSTPSTPSTPITPGTPSTP 171 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S G PSTP TP PSTP Sbjct: 425 PCTHSTPGTPSTPSTPSTPSTP 446 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTPGESAHVVQLL 259 P S PSTP TP PST H+V L+ Sbjct: 551 PSTPSTPSTPSTPSTPSTPSTLVHLVHLVHLV 582 Score = 29.9 bits (64), Expect = 2.2 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S PSTP+TP PSTP Sbjct: 700 PSTPSTPSTPSTPITPGTPSTP 721 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S PSTP+TP PSTP Sbjct: 39 PCTPSTPSTPSTPITPSTPSTP 60 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S+ PSTP TP PSTP Sbjct: 252 PSTPSMPSTPSTPSTPSTPSTP 273 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P G PSTP TP AP TP Sbjct: 506 PSAPGTPGTPSTPSTPSAPGTP 527 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S PSTP TP PSTP Sbjct: 643 PSTPSTRSTPSTPSTPSTPSTP 664 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S+ PSTP TP PSTP Sbjct: 691 PSTPSMPNTPSTPSTPSTPSTP 712 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S+ PSTP TP PSTP Sbjct: 802 PSTPSMPSTPSTPSTPSTPSTP 823 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S PSTP TP PSTP Sbjct: 18 PSTPSTPSTPSTPRTPSTPSTP 39 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S PSTP TP PSTP Sbjct: 129 PSTPSTPSTPSTPSTPSTPSTP 150 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S PSTP TP PSTP Sbjct: 132 PSTPSTPSTPSTPSTPSTPSTP 153 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S PSTP TP PSTP Sbjct: 135 PSTPSTPSTPSTPSTPSTPSTP 156 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S PSTP TP PSTP Sbjct: 138 PSTPSTPSTPSTPSTPSTPSTP 159 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S PSTP TP PSTP Sbjct: 141 PSTPSTPSTPSTPSTPSTPSTP 162 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTPG 232 P S PSTP TP P TPG Sbjct: 144 PSTPSTPSTPSTPSTPSTPITPG 166 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P G PSTP TP AP TP Sbjct: 159 PSTPITPGTPSTPSTPSAPGTP 180 Score = 28.7 bits (61), Expect = 5.1 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +2 Query: 122 SSLLGEMSNEDSKEPKDGSVEGPPSTPLTPRAPSTP 229 S+L ++ P S PSTP TP PSTP Sbjct: 235 STLSTPITPSTPSTPSTPSTPSMPSTPSTPSTPSTP 270 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S PSTP TP PSTP Sbjct: 383 PSTPSTPSTPSTPRTPSTPSTP 404 Score = 28.7 bits (61), Expect = 5.1 Identities = 24/77 (31%), Positives = 29/77 (37%), Gaps = 1/77 (1%) Frame = +2 Query: 2 PLMPSVTNGESSMCESRYRSPVSPATNPFSINDFEFEPWASSLLGEMSNEDSKE-PKDGS 178 P PS + S+ S S ++ P S P A G S + P S Sbjct: 470 PSTPSTPSTPSTPSTPSTPSTPSTSSTP-STPSTPSTPSAPGTPGTPSTPSTPSAPGTPS 528 Query: 179 VEGPPSTPLTPRAPSTP 229 PSTP TP PSTP Sbjct: 529 TPSTPSTPSTPSTPSTP 545 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S PSTP TP PSTP Sbjct: 527 PSTPSTPSTPSTPSTPSTPSTP 548 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S PSTP TP PSTP Sbjct: 646 PSTRSTPSTPSTPSTPSTPSTP 667 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S PSTP TP PSTP Sbjct: 652 PSTPSTPSTPSTPSTPSTPSTP 673 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P G PSTP TP AP TP Sbjct: 709 PSTPITPGTPSTPSTPSAPGTP 730 Score = 28.7 bits (61), Expect = 5.1 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +2 Query: 122 SSLLGEMSNEDSKEPKDGSVEGPPSTPLTPRAPSTP 229 S+L ++ P S PSTP TP PSTP Sbjct: 785 STLSTPITPSTPSTPSTPSTPSMPSTPSTPSTPSTP 820 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S PSTP TP PSTP Sbjct: 126 PSAPSTPSTPSTPSTPSTPSTP 147 Score = 28.3 bits (60), Expect = 6.7 Identities = 23/76 (30%), Positives = 30/76 (39%) Frame = +2 Query: 2 PLMPSVTNGESSMCESRYRSPVSPATNPFSINDFEFEPWASSLLGEMSNEDSKEPKDGSV 181 P+ PS + S+ RS S + P + + S M N S P S Sbjct: 180 PITPSTLSTPSTPSTPSTRSTPSTPSTPSTPSTLSMPSTPS-----MPNTPST-PSTPST 233 Query: 182 EGPPSTPLTPRAPSTP 229 STP+TP PSTP Sbjct: 234 PSTLSTPITPSTPSTP 249 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S PSTP TP PSTP Sbjct: 533 PSTPSTPSTPSTPSTPSMPSTP 554 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S PSTP TP PSTP Sbjct: 542 PSTPSTPSMPSTPSTPSTPSTP 563 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 164 PKDGSVEGPPSTPLTPRAPSTP 229 P S+ PSTP TP PSTP Sbjct: 670 PSTPSLTHTPSTPSTPSTPSTP 691 Score = 28.3 bits (60), Expect = 6.7 Identities = 23/76 (30%), Positives = 30/76 (39%) Frame = +2 Query: 2 PLMPSVTNGESSMCESRYRSPVSPATNPFSINDFEFEPWASSLLGEMSNEDSKEPKDGSV 181 P+ PS + S+ RS S + P + + S M N S P S Sbjct: 730 PITPSTLSTPSTPSTPSTRSTPSTPSTPSTPSTLSMPSTPS-----MPNTPST-PSTPST 783 Query: 182 EGPPSTPLTPRAPSTP 229 STP+TP PSTP Sbjct: 784 PSTLSTPITPSTPSTP 799 >SB_8792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1045 Score = 29.5 bits (63), Expect = 2.9 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -1 Query: 213 RGVSGVEGGPSTDPSLGSLESSFDISPRREE 121 RG S E G S D S +S+F +SP R+E Sbjct: 50 RGRSDKEAGTSVDSSKRGYKSTFSVSPLRDE 80 >SB_59749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1091 Score = 29.1 bits (62), Expect = 3.9 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = -2 Query: 698 STTAGKRSALSLEHTANYCSEALLLPSSVSSSDFIV 591 +T+ K +ALS H A SEALL + +S+D +V Sbjct: 142 ATSNAKENALSATHGARALSEALLFEITFASADQVV 177 >SB_31470| Best HMM Match : SAND (HMM E-Value=5e-37) Length = 912 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +2 Query: 191 PSTPLTPRAPSTPGES 238 P TPLTP AP TPG S Sbjct: 631 PMTPLTPMAPMTPGLS 646 >SB_7441| Best HMM Match : Collagen (HMM E-Value=0.05) Length = 510 Score = 29.1 bits (62), Expect = 3.9 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 237 LSPGVEGARGVSGVEGGPSTDPSLGS 160 L+ GV+G RG G +G P D S GS Sbjct: 9 LNLGVQGPRGEQGPQGAPGRDGSSGS 34 >SB_3524| Best HMM Match : ETS_PEA3_N (HMM E-Value=5.8) Length = 357 Score = 29.1 bits (62), Expect = 3.9 Identities = 16/56 (28%), Positives = 23/56 (41%) Frame = +3 Query: 522 HSAGQHSMQQLHHNNSDVLLKILNDKIRRRYGGREKKRFGTVIRSMFQAQRAPLPS 689 H H +H N D + D RRR R ++R+G V R + + PS Sbjct: 287 HEGPTHIRTSVHRNVGDAAEQDYKDHHRRRSHNRPRRRYGWVGRKVLREDFTKDPS 342 >SB_56934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2541 Score = 29.1 bits (62), Expect = 3.9 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = -2 Query: 698 STTAGKRSALSLEHTANYCSEALLLPSSVSSSDFIV 591 +T+ K +ALS H A SEALL + +S+D +V Sbjct: 1324 ATSNAKENALSATHGARALSEALLFEITFASADQVV 1359 >SB_31262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 29.1 bits (62), Expect = 3.9 Identities = 22/75 (29%), Positives = 33/75 (44%) Frame = +2 Query: 5 LMPSVTNGESSMCESRYRSPVSPATNPFSINDFEFEPWASSLLGEMSNEDSKEPKDGSVE 184 L+ + T + SR RS +SPA+ + P +S ++ + + S Sbjct: 161 LLEAFTAAAGTPAGSR-RSSISPASPALRSSLGSLAP--TSRTSTPTSRSTPRSRSRSRA 217 Query: 185 GPPSTPLTPRAPSTP 229 PSTP TP PSTP Sbjct: 218 RTPSTPSTPSTPSTP 232 >SB_47423| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 855 Score = 28.7 bits (61), Expect = 5.1 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 543 MQQLHHNNSDVLLKILNDKIRRRYGGREKKRFGTVIRSMFQAQRAPLPSCCRTANGP 713 +QQL + V+ ++ D++ + + + + I S PLP+C R A P Sbjct: 422 IQQLRFDEYQVIDEVFADRVHKEFVAVGEVSNASAILSKISQNPLPLPNCSRLARVP 478 >SB_4689| Best HMM Match : Dicty_CTDC (HMM E-Value=5.8) Length = 530 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -2 Query: 380 VASSSSCFNKSFRIRLFELEFASEDE 303 VASSSS F K+ ++F ++FA D+ Sbjct: 178 VASSSSVFQKAVHFKVFVIDFALHDD 203 >SB_33252| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 28.3 bits (60), Expect = 6.7 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +2 Query: 137 EMSNEDSKEPKDGSVEGPPSTPLTPRAPSTPGESA 241 E E++KE + SVE P TPL P P SA Sbjct: 78 EEEEENTKEEERQSVEEPLGTPLAMIPPKRPSMSA 112 >SB_6496| Best HMM Match : Collagen (HMM E-Value=0) Length = 1234 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -1 Query: 231 PGVEGARGVSGVEGGPSTDPSLG 163 PG G RG+ GV+G P D S G Sbjct: 244 PGERGDRGILGVQGEPGKDGSPG 266 >SB_33716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 922 Score = 28.3 bits (60), Expect = 6.7 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = +2 Query: 20 TNGESSMCESRYRSPVSPATNPFSINDFEFEPWASSLLGEMSNEDSKEP-KDGSVEG 187 +N SS C S +P++P NPFS P + E E ++P +GS G Sbjct: 435 SNQSSSHCNSSQLAPMTPPRNPFSPEMLTSTPNIVTSAHETEVEGHQQPICEGSFAG 491 >SB_26017| Best HMM Match : Extensin_2 (HMM E-Value=0.11) Length = 1704 Score = 28.3 bits (60), Expect = 6.7 Identities = 21/83 (25%), Positives = 32/83 (38%), Gaps = 6/83 (7%) Frame = +2 Query: 29 ESSMCESR--YRSPVSPATN----PFSINDFEFEPWASSLLGEMSNEDSKEPKDGSVEGP 190 +S+ C SR R P SP++ P D F P + +S PK+ S P Sbjct: 1032 DSNPCSSRSPIRMPASPSSRGGSAPLPSFDAMFSPTKQKSFPPAPDSNSTSPKEKSKRSP 1091 Query: 191 PSTPLTPRAPSTPGESAHVVQLL 259 + PR + ++LL Sbjct: 1092 VTKASKPRGKKVANKKQGALRLL 1114 >SB_52295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1325 Score = 27.9 bits (59), Expect = 8.9 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = +2 Query: 89 SINDFEFEPWASSLLGEMSNEDSKEPKDGSVEGPPSTPLT-PRAPSTPGESAHVVQL 256 +I+D + ++ + +M NE S S S T PR +TP +H+ QL Sbjct: 102 AIDDIQSRAFSKTKTSKMKNEGSSTISSKSTTESSSAGSTIPRVKTTPSSKSHLSQL 158 >SB_39538| Best HMM Match : VWA (HMM E-Value=0) Length = 3208 Score = 27.9 bits (59), Expect = 8.9 Identities = 12/45 (26%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +3 Query: 549 QLHHNN-SDVLLKILNDKIRRRYGGREKKRFGTVIRSMFQAQRAP 680 ++HH ++ ++ ND ++ R+G REK R I ++ + + P Sbjct: 2999 RIHHEKPANDYVQSRNDHVQSRFGAREKSRIRRGIEAILRGRTKP 3043 >SB_22107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 383 Score = 27.9 bits (59), Expect = 8.9 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 5/33 (15%) Frame = -1 Query: 231 PGVEGARGVSGVEG-----GPSTDPSLGSLESS 148 PGV G RG+ G EG GP DP ++E + Sbjct: 75 PGVPGPRGMQGEEGPAGNKGPQGDPGPAAMEGN 107 >SB_21683| Best HMM Match : Fe_dep_repress (HMM E-Value=4) Length = 268 Score = 27.9 bits (59), Expect = 8.9 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = +2 Query: 14 SVTNGESSMCESRYRSPVSPAT-NPFSINDF-EFEPWASSLLGEMSNEDSKEPKDGS 178 S+ NG SR P+SP T S+ + E++ W S S+EDS +DGS Sbjct: 138 SLCNGFKLAIRSRRSKPISPTTRKSHSMTNLNEYKDWTSD-----SSEDSFRIRDGS 189 >SB_9550| Best HMM Match : GPS (HMM E-Value=1.6e-11) Length = 1771 Score = 27.9 bits (59), Expect = 8.9 Identities = 17/65 (26%), Positives = 28/65 (43%) Frame = +2 Query: 92 INDFEFEPWASSLLGEMSNEDSKEPKDGSVEGPPSTPLTPRAPSTPGESAHVVQLLKSQI 271 I +++ AS+ G M ED + + PL+P AP ES +V ++ Sbjct: 1062 IMSVDYDSDASANGGHMRREDPQNEESPPDIAKDDKPLSPEAPIAEAESILLVAEVEPGA 1121 Query: 272 GYERC 286 +E C Sbjct: 1122 KFETC 1126 >SB_10537| Best HMM Match : CTP_transf_2 (HMM E-Value=0) Length = 816 Score = 27.9 bits (59), Expect = 8.9 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -1 Query: 699 FDNSWEEERAELGTYCELLFRSASSPFLR 613 F+N +E +A+L TY + L + SPF+R Sbjct: 466 FNNIGKELKADLQTYYQTLIDTRDSPFIR 494 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,267,070 Number of Sequences: 59808 Number of extensions: 374549 Number of successful extensions: 1729 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1319 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1633 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -