BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30871 (729 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 26 0.42 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 25 0.97 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 2.2 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 23 3.9 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 6.8 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 25.8 bits (54), Expect = 0.42 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 114 GSNSKSFIENGFVAGLT 64 G S+ F+EN ++AGLT Sbjct: 277 GPESRGFVENSYLAGLT 293 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 24.6 bits (51), Expect = 0.97 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 228 GVEGARGVSGVEGGP 184 GV+G +GV GV+G P Sbjct: 861 GVQGVQGVQGVQGVP 875 Score = 23.4 bits (48), Expect = 2.2 Identities = 16/55 (29%), Positives = 24/55 (43%) Frame = -1 Query: 228 GVEGARGVSGVEGGPSTDPSLGSLESSFDISPRREEAQGSNSKSFIENGFVAGLT 64 GV+G +GV GV+G G L+ + + QG N ++ G G T Sbjct: 855 GVQGVQGVQGVQGVQGVQGVPGLLQGVQQVF--GQGVQGMNVPYGMQRGQSGGQT 907 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -1 Query: 228 GVEGARGVSGVEG 190 GV+G +GV GV+G Sbjct: 852 GVQGVQGVQGVQG 864 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -1 Query: 228 GVEGARGVSGVEG 190 GV+ A+GV GV+G Sbjct: 846 GVQTAQGVQGVQG 858 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -1 Query: 693 NSWEEERAELGTYCELLFRSASSPFLR 613 NS AELG +C ++ +A P LR Sbjct: 328 NSLRLSDAELGLFCSVVVIAADRPGLR 354 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 22.6 bits (46), Expect = 3.9 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +2 Query: 122 SSLLGEMSNEDSKEPKDGSVEGPPSTPLTPRAPSTPGESA 241 SSL G +EP G + S+P ++PS SA Sbjct: 603 SSLYGRFKRGKYEEPTVGEISQDGSSPHFHQSPSQNHSSA 642 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.8 bits (44), Expect = 6.8 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 111 SNSKSFIENGFVAGLTGDRY 52 ++ KS ENG G+ D+Y Sbjct: 160 NDEKSLFENGVEIGINFDKY 179 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,871 Number of Sequences: 438 Number of extensions: 3735 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -