BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30867 (743 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 2.0 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 23 2.6 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 23 3.4 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 22 4.5 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 22 4.5 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 22 4.5 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 22 4.5 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 6.0 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 22 6.0 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.4 bits (48), Expect = 2.0 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -3 Query: 195 CVFYFYLHFVLY 160 C++YFY F+L+ Sbjct: 237 CIYYFYYAFILF 248 Score = 23.0 bits (47), Expect = 2.6 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -3 Query: 195 CVFYFYLHFVLY 160 CV+YFY F+++ Sbjct: 112 CVYYFYYAFIIF 123 Score = 22.6 bits (46), Expect = 3.4 Identities = 5/12 (41%), Positives = 10/12 (83%) Frame = -3 Query: 195 CVFYFYLHFVLY 160 C++YFY F+++ Sbjct: 145 CIYYFYCAFIIF 156 Score = 22.2 bits (45), Expect = 4.5 Identities = 5/12 (41%), Positives = 10/12 (83%) Frame = -3 Query: 195 CVFYFYLHFVLY 160 C++YFY F+++ Sbjct: 211 CIYYFYSAFIIF 222 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 439 IILFHCSIF*YVLLTISLCNLVRAKIEVFI 350 + FH S YV++ L N+V +E+FI Sbjct: 276 VFFFHLSDVRYVMVVYLLKNVVLYGLELFI 305 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 22.6 bits (46), Expect = 3.4 Identities = 6/20 (30%), Positives = 12/20 (60%) Frame = -1 Query: 308 YEVFYWQKLLNLPILLFLWS 249 Y+++ W L + +L LW+ Sbjct: 546 YQLYCWSSFLKISVLQSLWA 565 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +3 Query: 435 MITL*LRLGIYHWLEIENKELPLKAPTKMKTEILTV 542 ++TL RLGI +L E++ L + +K ++ + Sbjct: 129 LVTLNYRLGILGFLRFEDQSLGVPGNAGLKDMVMAL 164 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +3 Query: 435 MITL*LRLGIYHWLEIENKELPLKAPTKMKTEILTV 542 ++TL RLGI +L E++ L + +K ++ + Sbjct: 131 LVTLNYRLGILGFLRFEDQSLGVPGNAGLKDMVMAL 166 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +3 Query: 435 MITL*LRLGIYHWLEIENKELPLKAPTKMKTEILTV 542 ++TL RLGI +L E++ L + +K ++ + Sbjct: 129 LVTLNYRLGILGFLRFEDQSLGVPGNAGLKDMVMAL 164 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +3 Query: 435 MITL*LRLGIYHWLEIENKELPLKAPTKMKTEILTV 542 ++TL RLGI +L E++ L + +K ++ + Sbjct: 131 LVTLNYRLGILGFLRFEDQSLGVPGNAGLKDMVMAL 166 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/28 (28%), Positives = 16/28 (57%) Frame = -1 Query: 617 LGFNKVKINSCCIIINHVKRIFSGLNCK 534 +GF KVK N +++ V+ + + C+ Sbjct: 623 VGFLKVKENEITLLVATVRHVMAPSTCQ 650 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.8 bits (44), Expect = 6.0 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +2 Query: 428 KEDDYFVAPTGNIP 469 + DD+ +P+GN+P Sbjct: 102 RTDDWLSSPSGNVP 115 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,197 Number of Sequences: 336 Number of extensions: 4160 Number of successful extensions: 18 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -