BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30867 (743 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC320.13c |ark1|aim1, SPCC330.16|aurora-B kinase Ark1|Schizosa... 29 0.92 SPAC13G7.05 |||acyl-coA-sterol acyltransferase |Schizosaccharomy... 26 4.9 SPCC126.09 |||vacuolar membrane zinc transporter |Schizosaccharo... 26 6.5 SPAC869.10c |||proline specific permease |Schizosaccharomyces po... 25 8.6 >SPCC320.13c |ark1|aim1, SPCC330.16|aurora-B kinase Ark1|Schizosaccharomyces pombe|chr 3|||Manual Length = 355 Score = 28.7 bits (61), Expect = 0.92 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +2 Query: 11 IIFFFNKLHKHKRIYLIINYAISIYRLKSCYNSKNFVQELLFKSTFQ 151 I+ + H KRIYLI+ +A + +K F +E+ K FQ Sbjct: 149 ILRLYGHFHDEKRIYLILEFAGRGELYQHLRRAKRFSEEVASKYIFQ 195 >SPAC13G7.05 |||acyl-coA-sterol acyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 537 Score = 26.2 bits (55), Expect = 4.9 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = -1 Query: 359 GFHFLGWYKEVLYCQCLYEVFYWQK--LLNLPI 267 GF+ L W + LY YWQ+ LL LP+ Sbjct: 100 GFYVLFWLSMAAWVLQLYARSYWQRDTLLGLPL 132 >SPCC126.09 |||vacuolar membrane zinc transporter |Schizosaccharomyces pombe|chr 3|||Manual Length = 418 Score = 25.8 bits (54), Expect = 6.5 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 249 YHTLLVKVFQAAL*YSDQCVFYFYLHFV 166 + T LV+VFQ + VFY + HF+ Sbjct: 110 FDTFLVRVFQFCAFFFGGIVFYIFNHFL 137 >SPAC869.10c |||proline specific permease |Schizosaccharomyces pombe|chr 1|||Manual Length = 552 Score = 25.4 bits (53), Expect = 8.6 Identities = 10/39 (25%), Positives = 18/39 (46%) Frame = -2 Query: 529 SVFIFVGAFKGSSLFSISSQWYIPSRSYKVIILFHCSIF 413 S++ + +F ++W +P S V +LF C F Sbjct: 359 SIYSLAKEHQAPKIFKYCNRWGVPVISVAVTVLFACLAF 397 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,082,896 Number of Sequences: 5004 Number of extensions: 67594 Number of successful extensions: 168 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 166 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 168 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 353266144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -