BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30867 (743 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54629| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 1.7 SB_42197| Best HMM Match : rve (HMM E-Value=0.017) 28 9.2 >SB_54629| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1296 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +3 Query: 147 SKPVSTVQNEDKNKIRIDPSTITLLERLSLVKYDTP 254 SK S + E K +RI+P+ + SLVKYD P Sbjct: 17 SKSRSAPKQETKTLLRINPNFTMIPPNASLVKYDNP 52 >SB_42197| Best HMM Match : rve (HMM E-Value=0.017) Length = 602 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -1 Query: 647 QHGYFPLIP*LGFNKVKINSCCIIINHVKRIFS 549 Q+ FP+I LG + V + ++INH+K IFS Sbjct: 520 QYSKFPIIRKLG-SAVGSTTSLVVINHLKSIFS 551 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,380,415 Number of Sequences: 59808 Number of extensions: 434966 Number of successful extensions: 868 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 863 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2010148439 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -