BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30864 (826 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0322 - 2898272-2898475,2898548-2898730,2898817-2899702,290... 33 0.28 10_08_0782 + 20517103-20519601 29 5.9 >08_01_0322 - 2898272-2898475,2898548-2898730,2898817-2899702, 2902070-2902374 Length = 525 Score = 33.1 bits (72), Expect = 0.28 Identities = 32/101 (31%), Positives = 49/101 (48%), Gaps = 8/101 (7%) Frame = -1 Query: 541 SRFKALRCFNFNSFSTVIISSLFSDSRAIHSLSMV-AKSNSSIFSAISIKLSTRLRHSEC 365 S K L C N+ S S + I +LFS A+ L MV ++ FS+ S+K T HS Sbjct: 260 SHLKIL-CLNYVSISDLFIENLFSGCPALQDLVMVDCCVYATRFSSSSLKNLTFTSHSPD 318 Query: 364 EA-LCTVS*EEIYLSTRS------QKCKVLSPCLILASSIK 263 L +++ + T S + L+PCL+ ASS++ Sbjct: 319 NGDLVHDDFKDLVIDTPSLVSLHLEYLPFLAPCLLNASSVE 359 >10_08_0782 + 20517103-20519601 Length = 832 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = +3 Query: 312 WERVDKYISS-QDTVHSASHSECLKRVDSLIDIAEKIE 422 +E VDK + + ++ VH +H + LK +DS+ + E IE Sbjct: 360 YEVVDKGVETVKEVVHYHAHRDVLKELDSIAEQIEAIE 397 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,914,031 Number of Sequences: 37544 Number of extensions: 372939 Number of successful extensions: 753 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 753 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2268190812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -