BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30862 (895 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ618927-1|CAF02006.1| 235|Anopheles gambiae odorant-binding pr... 26 1.8 AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. 25 4.1 AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 25 4.1 AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 25 4.1 AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylch... 24 7.2 >AJ618927-1|CAF02006.1| 235|Anopheles gambiae odorant-binding protein OBPjj7a protein. Length = 235 Score = 25.8 bits (54), Expect = 1.8 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +2 Query: 572 NFKRIHHLYKPCGLRVLKKEKKEGLVIP 655 N ++IH + K C + V K K +G P Sbjct: 71 NMEKIHEIKKQCFMEVRNKNKADGAYEP 98 >AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. Length = 194 Score = 24.6 bits (51), Expect = 4.1 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +2 Query: 308 DPDPEQLTDIEDASFLLQQKLPEPINHERACTKC 409 DPD ++TD E A+ ++ +L EP++ + C KC Sbjct: 160 DPDGVRMTDHESAT--MEIRLKEPVDCK--CFKC 189 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 24.6 bits (51), Expect = 4.1 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -1 Query: 775 LLRTPLLEALSPLI*SNHLNVEIREDVFHPIAPTV 671 LL T +L LS ++ LNV R V H +AP V Sbjct: 306 LLFTMMLVTLSVVVTIAVLNVNFRSPVTHRMAPWV 340 >AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein protein. Length = 400 Score = 24.6 bits (51), Expect = 4.1 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +3 Query: 390 REHALNVRIYPFVLCICGIREAHQSLKIIRC 482 +E LN C+C +REA +K +C Sbjct: 303 KERVLNPGKLKVGWCVCSLREATVQVKCFKC 333 >AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 2 protein. Length = 569 Score = 23.8 bits (49), Expect = 7.2 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -1 Query: 775 LLRTPLLEALSPLI*SNHLNVEIREDVFHPIAPTVFNFQI 656 LL T +L LS +I LN+ R+ H +AP V F I Sbjct: 319 LLFTMILVGLSVVITIIILNIHYRKPSTHKMAPWVRKFFI 358 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 977,656 Number of Sequences: 2352 Number of extensions: 22153 Number of successful extensions: 37 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 96334083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -