BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30861 (810 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) 161 5e-40 SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) 158 6e-39 SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) 155 4e-38 SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) 118 7e-27 SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 1e-22 SB_51590| Best HMM Match : HSP70 (HMM E-Value=4.4e-36) 78 1e-14 SB_15336| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_37014| Best HMM Match : HSP70 (HMM E-Value=5.9e-16) 67 1e-11 SB_47391| Best HMM Match : HSP70 (HMM E-Value=2.7e-07) 65 6e-11 SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_47390| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_50451| Best HMM Match : Avirulence (HMM E-Value=0.14) 33 0.36 SB_24074| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.36 SB_31943| Best HMM Match : ResIII (HMM E-Value=1.6) 32 0.63 SB_29335| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.63 SB_29289| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_27085| Best HMM Match : Filamin (HMM E-Value=1.5) 31 1.5 SB_41892| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_41920| Best HMM Match : Filamin (HMM E-Value=0.00015) 30 2.6 SB_28120| Best HMM Match : ScdA_N (HMM E-Value=6.5) 30 2.6 SB_43375| Best HMM Match : Pneumo_att_G (HMM E-Value=3.6) 29 3.4 SB_19421| Best HMM Match : Ribosomal_L36 (HMM E-Value=0.85) 29 3.4 SB_48737| Best HMM Match : WD40 (HMM E-Value=1.5e-36) 29 4.5 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_38784| Best HMM Match : Apo-VLDL-II (HMM E-Value=8.3) 29 5.9 SB_55740| Best HMM Match : C1_1 (HMM E-Value=3.6) 29 5.9 SB_52369| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.18) 28 7.8 SB_25455| Best HMM Match : DUF948 (HMM E-Value=0.11) 28 7.8 >SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1097 Score = 161 bits (392), Expect = 5e-40 Identities = 73/90 (81%), Positives = 85/90 (94%) Frame = +2 Query: 2 RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 181 RNVLI+DLGGGTFDVS+LTIEDGIFEVKSTAGDTHLGGEDFDN+MV+HFV++FK+KYKKD Sbjct: 193 RNVLIYDLGGGTFDVSVLTIEDGIFEVKSTAGDTHLGGEDFDNKMVDHFVKQFKQKYKKD 252 Query: 182 LATNKRALMRLRTACERAKRTLSSSHKRAL 271 + NKRA+ RLRTACERAKRTLSSS + ++ Sbjct: 253 ITPNKRAMRRLRTACERAKRTLSSSTQASI 282 Score = 140 bits (338), Expect = 2e-33 Identities = 69/93 (74%), Positives = 78/93 (83%), Gaps = 2/93 (2%) Frame = +1 Query: 235 KEDLVIVTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKM--DK 408 K L TQASIEIDSLFEGIDFYTSITRARFEELN DLF+ T EPVE+++RD+K+ K Sbjct: 271 KRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELNQDLFKKTTEPVEQAIRDSKIPGGK 330 Query: 409 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNK 507 IHDIVLVGGSTRIPK+QK+LQ+ F GKELNK Sbjct: 331 ESIHDIVLVGGSTRIPKIQKMLQELFGGKELNK 363 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/43 (51%), Positives = 25/43 (58%) Frame = +3 Query: 492 KGAQQIINPDEXXXXXXXXXXXILHGDKSEEVQDLLLLDVTPL 620 K + INPDE ILHGDK + V+DLLLLDV PL Sbjct: 359 KELNKSINPDEAVAYGAAVQAAILHGDKDDTVKDLLLLDVAPL 401 Score = 31.9 bits (69), Expect = 0.63 Identities = 22/52 (42%), Positives = 28/52 (53%) Frame = +2 Query: 617 PFPSGIENSGGVMNHTSSSVNTTIPN*NRLQTFHQPNS**PNPGYSIQVFKG 772 P GIE +GGVM+ N+TIP + QTF + PG IQVF+G Sbjct: 400 PLSMGIETAGGVMS-VLIKRNSTIPT-KQTQTFTTYSD--NQPGVLIQVFEG 447 >SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) Length = 640 Score = 158 bits (383), Expect = 6e-39 Identities = 74/91 (81%), Positives = 84/91 (92%), Gaps = 1/91 (1%) Frame = +2 Query: 2 RNVLIFDLGGGTFDVSILTIEDG-IFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK 178 +NVLIFDLGGGTFDVSILTI+DG +FEVKSTAGDTHLGGEDFDNR+VNHFV EFKRKYKK Sbjct: 193 KNVLIFDLGGGTFDVSILTIDDGSLFEVKSTAGDTHLGGEDFDNRLVNHFVAEFKRKYKK 252 Query: 179 DLATNKRALMRLRTACERAKRTLSSSHKRAL 271 D++ N RA+ RLRTACERAKRTLSSS + ++ Sbjct: 253 DMSKNSRAMRRLRTACERAKRTLSSSTEASI 283 Score = 130 bits (313), Expect = 2e-30 Identities = 58/91 (63%), Positives = 76/91 (83%) Frame = +1 Query: 235 KEDLVIVTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 414 K L T+ASIE+DSLFEGIDFYT I+RARFE+L +DLF S ++PV K+L DAK K+ Sbjct: 272 KRTLSSSTEASIEVDSLFEGIDFYTKISRARFEDLCSDLFLSCLDPVNKALSDAKFSKSD 331 Query: 415 IHDIVLVGGSTRIPKVQKLLQDFFNGKELNK 507 IH++VLVGGSTR+PK+QK+L+++F+GK LNK Sbjct: 332 IHEVVLVGGSTRVPKIQKMLEEYFSGKSLNK 362 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/77 (32%), Positives = 38/77 (49%) Frame = +3 Query: 492 KGAQQIINPDEXXXXXXXXXXXILHGDKSEEVQDLLLLDVTPLFPRVLRILEVS*TTLHQ 671 K + INPDE IL GDKS+EV+D+LL+DV PL + EV + + Sbjct: 358 KSLNKSINPDEAVAYGAAVQAAILSGDKSDEVKDVLLVDVAPLSLGIETAGEVMTKLIER 417 Query: 672 ALTLPSPIKTDFRHFTN 722 +P+ F +++ Sbjct: 418 NARIPTKATQTFTTYSD 434 >SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 155 bits (376), Expect = 4e-38 Identities = 72/90 (80%), Positives = 82/90 (91%) Frame = +2 Query: 2 RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 181 RNVLIFDLGGGTFDVS+L+IEDGIFEVKST GDTHLGGEDFDN MV+ FV++FK+KYKKD Sbjct: 286 RNVLIFDLGGGTFDVSVLSIEDGIFEVKSTHGDTHLGGEDFDNNMVDFFVKQFKQKYKKD 345 Query: 182 LATNKRALMRLRTACERAKRTLSSSHKRAL 271 + NKRAL RLRTACERAKRTLSSS + ++ Sbjct: 346 ITPNKRALRRLRTACERAKRTLSSSTQASI 375 Score = 137 bits (332), Expect = 9e-33 Identities = 65/92 (70%), Positives = 81/92 (88%), Gaps = 1/92 (1%) Frame = +1 Query: 235 KEDLVIVTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMD-KA 411 K L TQASIEIDSL++GIDFYTSITRARFEE+NA LF+ T+EPVEK+++D+K++ K Sbjct: 364 KRTLSSSTQASIEIDSLYDGIDFYTSITRARFEEMNAHLFKKTLEPVEKAIKDSKLESKE 423 Query: 412 QIHDIVLVGGSTRIPKVQKLLQDFFNGKELNK 507 +I +IV+VGGSTRIPK+Q LLQ+FFNGKELNK Sbjct: 424 KIDEIVMVGGSTRIPKIQSLLQNFFNGKELNK 455 Score = 47.6 bits (108), Expect = 1e-05 Identities = 32/84 (38%), Positives = 40/84 (47%) Frame = +3 Query: 492 KGAQQIINPDEXXXXXXXXXXXILHGDKSEEVQDLLLLDVTPLFPRVLRILEVS*TTLHQ 671 K + INPDE ILHGDKSE QDLLLLDV PL + V + + Sbjct: 451 KELNKSINPDEAVAYGAAVQAAILHGDKSEATQDLLLLDVAPLTLGLETAGGVMTAAIKR 510 Query: 672 ALTLPSPIKTDFRHFTNLTLDNQT 743 T+P+ F ++ DNQT Sbjct: 511 NTTIPTKQTQTFTTYS----DNQT 530 >SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1327 Score = 118 bits (283), Expect = 7e-27 Identities = 56/90 (62%), Positives = 71/90 (78%) Frame = +1 Query: 229 EGKEDLVIVTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 408 + K L QA +EI+S FEG DF +TRARFEELNA LF+ST++PV+K L DA + K Sbjct: 966 KAKRALSTQHQARVEIESFFEGEDFSEMLTRARFEELNAKLFKSTLKPVQKVLEDADLKK 1025 Query: 409 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKE 498 ++IH+IVLVGGSTRIPKVQ+L++DFF GKE Sbjct: 1026 SEIHEIVLVGGSTRIPKVQQLVKDFFEGKE 1055 Score = 115 bits (277), Expect = 4e-26 Identities = 48/87 (55%), Positives = 70/87 (80%) Frame = +2 Query: 2 RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 181 +N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD ++ HF++ +K+K K+ Sbjct: 890 KNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQNVMEHFIKLYKKKKGKN 949 Query: 182 LATNKRALMRLRTACERAKRTLSSSHK 262 + + RA+ +LR E+AKR LS+ H+ Sbjct: 950 IRKDNRAVQKLRREVEKAKRALSTQHQ 976 >SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 766 Score = 103 bits (248), Expect = 1e-22 Identities = 47/83 (56%), Positives = 63/83 (75%) Frame = +2 Query: 8 VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 187 + ++DLGGGTFD+SIL I+ G+FEVK+T GDT+LGGEDFDN ++ + EFK++ DL+ Sbjct: 2 IAVYDLGGGTFDISILEIQKGVFEVKATNGDTYLGGEDFDNTLLKFLIAEFKKESGVDLS 61 Query: 188 TNKRALMRLRTACERAKRTLSSS 256 + AL RLR A E+AK LSSS Sbjct: 62 KDSMALQRLREAAEKAKIELSSS 84 Score = 67.3 bits (157), Expect = 1e-11 Identities = 29/58 (50%), Positives = 45/58 (77%) Frame = +1 Query: 313 ITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFF 486 ++R++FE L ADL T+ P +K L+DA+++K +I D++LVGG TR+PKVQ+ +QD F Sbjct: 108 LSRSKFESLVADLINRTVGPCKKCLQDAEINKGEIGDVLLVGGMTRMPKVQQTVQDIF 165 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = +3 Query: 510 INPDEXXXXXXXXXXXILHGDKSEEVQDLLLLDVTPL 620 +NPDE +L GD V+D+LLLDVTPL Sbjct: 173 VNPDEAVAIGAAIQGGVLAGD----VKDVLLLDVTPL 205 >SB_51590| Best HMM Match : HSP70 (HMM E-Value=4.4e-36) Length = 437 Score = 77.8 bits (183), Expect = 1e-14 Identities = 33/80 (41%), Positives = 57/80 (71%), Gaps = 3/80 (3%) Frame = +1 Query: 274 IDSLFEG---IDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGS 444 + SL EG + F +I+R FE +N DLF+ ++P+ + L + ++ K ++ ++VLVGGS Sbjct: 314 LPSLSEGKKIVKFKETISRKMFETINEDLFKKVLQPIRRVLAEVELPKEEVDEVVLVGGS 373 Query: 445 TRIPKVQKLLQDFFNGKELN 504 TR+PK+++L+Q+FF+GK N Sbjct: 374 TRVPKIRQLIQEFFDGKPPN 393 Score = 70.9 bits (166), Expect = 1e-12 Identities = 34/93 (36%), Positives = 58/93 (62%) Frame = +2 Query: 5 NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 184 NV++ DLGGGT DVS+L I+ G+F + AG+ LGG+DF+ R + + +Q +++ + L Sbjct: 223 NVMVVDLGGGTLDVSLLNIQGGMFVTMAMAGNNRLGGQDFNARFMQYLLQLIHKRFNRQL 282 Query: 185 ATNKRALMRLRTACERAKRTLSSSHKRALR*IL 283 T + RLR E AK L+ +++ ++ +L Sbjct: 283 -TCSEDIQRLRQEVEAAKINLTRTNEVTIKLML 314 >SB_15336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1068 Score = 73.3 bits (172), Expect = 2e-13 Identities = 35/85 (41%), Positives = 53/85 (62%) Frame = +2 Query: 2 RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 181 RNV+ D+G + V I G +V STA + +LGG DFD +V HF QEFK KYK D Sbjct: 253 RNVVFVDIGHSSLQVCITAFLKGQLKVLSTAVEPNLGGRDFDYVLVEHFAQEFKTKYKID 312 Query: 182 LATNKRALMRLRTACERAKRTLSSS 256 + ++ +A ++L CE+ K+ +S++ Sbjct: 313 VHSSIKAKIKLGAECEKLKKLMSAN 337 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/58 (31%), Positives = 31/58 (53%) Frame = +1 Query: 256 TQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIV 429 ++ I I+ E D + + RA+FEEL ADL + P+ +L A+ K + ++V Sbjct: 339 SEIPINIECFMEDKDVHGRMKRAQFEELAADLLKLVEAPLRSAL--AQSGKYSVKNVV 394 >SB_37014| Best HMM Match : HSP70 (HMM E-Value=5.9e-16) Length = 212 Score = 67.3 bits (157), Expect = 1e-11 Identities = 29/58 (50%), Positives = 45/58 (77%) Frame = +1 Query: 313 ITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFF 486 ++R++FE L ADL T+ P +K L+DA+++K +I D++LVGG TR+PKVQ+ +QD F Sbjct: 53 LSRSKFESLVADLINRTVGPCKKCLQDAEINKGEIGDVLLVGGMTRMPKVQQTVQDIF 110 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = +3 Query: 510 INPDEXXXXXXXXXXXILHGDKSEEVQDLLLLDVTPL 620 +NPDE +L GD V+D+LLLDVTPL Sbjct: 118 VNPDEAVAIGAAIQGGVLAGD----VKDVLLLDVTPL 150 >SB_47391| Best HMM Match : HSP70 (HMM E-Value=2.7e-07) Length = 592 Score = 65.3 bits (152), Expect = 6e-11 Identities = 33/87 (37%), Positives = 57/87 (65%), Gaps = 5/87 (5%) Frame = +2 Query: 8 VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKR-----KY 172 VL++ LGG + DV++L++ +G+++V +T D LGG +FD +++ +FKR K+ Sbjct: 156 VLVYRLGGASHDVTLLSVINGMYKVLATEYDGALGGRNFDEVLLDLLANDFKRQVLLWKW 215 Query: 173 KKDLATNKRALMRLRTACERAKRTLSS 253 K D TNKR+ +L+T+ E+ K LS+ Sbjct: 216 KIDPLTNKRSKTKLQTSAEQCKNILST 242 >SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 63.3 bits (147), Expect = 2e-10 Identities = 32/79 (40%), Positives = 43/79 (54%) Frame = +1 Query: 271 EIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTR 450 +I+ +F+G DF +TR EE+ DLF PV ++L+ A M I +VLVGG R Sbjct: 267 QIEGVFDGKDFRVKVTREELEEMCQDLFDRVAGPVNRALKSASMTMNDIDSVVLVGGGIR 326 Query: 451 IPKVQKLLQDFFNGKELNK 507 +PKVQ L EL K Sbjct: 327 VPKVQDALLRAVKKPELAK 345 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = +2 Query: 80 VKSTAGDTHLGGEDFDNRMVNHFVQEFKR--KYKKDLATNKRALMRLRTACERAKRTLSS 253 +K D LGG D R+ +H VQ FK+ K+K ++ + RA+ + R K+ LS+ Sbjct: 201 IKGIGFDRTLGGHAIDMRLRDHLVQLFKKNYKFKGEVTQSSRAMAKFYKEALRVKQVLSA 260 Query: 254 SHK 262 +++ Sbjct: 261 NNE 263 >SB_47390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/34 (44%), Positives = 28/34 (82%) Frame = +1 Query: 400 MDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEL 501 + ++ + ++LVGG+TR PK+Q+LL+++F GKE+ Sbjct: 35 LKQSSMIQVILVGGATRTPKIQQLLKNYFVGKEI 68 >SB_50451| Best HMM Match : Avirulence (HMM E-Value=0.14) Length = 1085 Score = 32.7 bits (71), Expect = 0.36 Identities = 28/88 (31%), Positives = 45/88 (51%), Gaps = 7/88 (7%) Frame = +2 Query: 32 GTFDV-SILTIEDGIFEVKSTAGDTHLG----GEDFDNRMVNHFVQEFKRKYKKD-LATN 193 GTFD+ I+ + + I E + + +L G + +V F ++R K L T Sbjct: 50 GTFDIIRIVCLRESIREFRFSHFRENLSLPLYGLPANKTVVRFFKTAYERVLKFCFLKTA 109 Query: 194 KRALMR-LRTACERAKRTLSSSHKRALR 274 +MR L+TACER R L +++KR +R Sbjct: 110 YEKVMRFLKTACERVMRFLKTAYKREMR 137 >SB_24074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/30 (46%), Positives = 23/30 (76%) Frame = +1 Query: 412 QIHDIVLVGGSTRIPKVQKLLQDFFNGKEL 501 +I + +VGGSTRIP ++ ++++ F GKEL Sbjct: 6 EIDSVEIVGGSTRIPAIKDIIKNVF-GKEL 34 >SB_31943| Best HMM Match : ResIII (HMM E-Value=1.6) Length = 1053 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 145 LCPGVQEEIQKGPRYQQESSYAFAYCM*EGKEDL 246 LCP ++ + GP +++E YAFA C+ D+ Sbjct: 202 LCPLPEQNGEHGPMFEREGIYAFANCVARSSSDM 235 >SB_29335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 840 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 145 LCPGVQEEIQKGPRYQQESSYAFAYCM*EGKEDL 246 LCP ++ + GP +++E YAFA C+ D+ Sbjct: 140 LCPLPEQNGEHGPMFEREGIYAFANCVARSSSDM 173 >SB_29289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 956 Score = 31.5 bits (68), Expect = 0.84 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +1 Query: 145 LCPGVQEEIQKGPRYQQESSYAFAYCM*EGK 237 LCP ++ + GP +++E AFA C+ GK Sbjct: 169 LCPSPEQNGEPGPMFEREGGDAFANCVARGK 199 >SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3235 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 5 NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDF 124 + LI D G+F VS E+GI ++ GD H+ G F Sbjct: 1428 DTLITDNQDGSFGVSYTPFEEGIHDLAVKFGDDHIPGSPF 1467 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 20 DLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDF 124 D G GT VS + +E+G +++ D H+ G F Sbjct: 1526 DNGDGTCSVSYIPVEEGDYDIHIKFADEHIPGSPF 1560 >SB_27085| Best HMM Match : Filamin (HMM E-Value=1.5) Length = 634 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/26 (42%), Positives = 20/26 (76%) Frame = +2 Query: 8 VLIFDLGGGTFDVSILTIEDGIFEVK 85 V I+DLG GT++++IL E G++ ++ Sbjct: 319 VPIYDLGNGTYEMAILFHEPGVYSIR 344 >SB_41892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 136 GQPLCPGVQEEIQKGPRYQQESSYAFAYCM 225 G LCP ++ + GP +++E S AFA C+ Sbjct: 218 GYKLCPLPEQNGEPGPMFEREGSDAFANCV 247 >SB_41920| Best HMM Match : Filamin (HMM E-Value=0.00015) Length = 600 Score = 29.9 bits (64), Expect = 2.6 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +2 Query: 14 IFDLGGGTFDVSILTIEDGIFEV 82 +FDLG G+++V L +E G++ V Sbjct: 311 VFDLGNGSYEVLFLVMEPGVYRV 333 >SB_28120| Best HMM Match : ScdA_N (HMM E-Value=6.5) Length = 452 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 145 LCPGVQEEIQKGPRYQQESSYAFAYCM*EGK 237 LCP ++ GP +++E S AFA C+ GK Sbjct: 206 LCPLPEQNGGPGPMFEREGSDAFANCVTRGK 236 >SB_43375| Best HMM Match : Pneumo_att_G (HMM E-Value=3.6) Length = 774 Score = 29.5 bits (63), Expect = 3.4 Identities = 19/49 (38%), Positives = 31/49 (63%), Gaps = 1/49 (2%) Frame = +3 Query: 18 LTSAAVPSTCPSLPSRMVSSR*NPPPATPTWEVRTL-TIAWSTTLSRSS 161 L S+A +T P+LP +V+ R PPP+T ++ T+ T+ STT + S+ Sbjct: 97 LDSSATTTTTPTLP--IVTLR--PPPSTSVTQIVTMTTVTISTTTAMST 141 >SB_19421| Best HMM Match : Ribosomal_L36 (HMM E-Value=0.85) Length = 647 Score = 29.5 bits (63), Expect = 3.4 Identities = 19/40 (47%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +3 Query: 87 PPPATPTWEVRTL-TIAWSTTLSRSSRGNTKRTSLPTREL 203 PPPA T E L T +W+ T S + R KRT LPT L Sbjct: 436 PPPAFQTDEPERLQTSSWTETASGTGREEFKRT-LPTAAL 474 >SB_48737| Best HMM Match : WD40 (HMM E-Value=1.5e-36) Length = 885 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +3 Query: 138 STTLSRSSRGNTKRTSLPTRELLCVCVLHVRGQRGPCHRHTSE 266 S LS S G K +LPT++ L H RG C HT + Sbjct: 80 SVLLSGSCDGEVKLWNLPTKDCLRTITAHKGFVRGLCVDHTGQ 122 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 Query: 21 TSAAVPSTCPSLPSRMVSSR*NPPPATP 104 T A P P++PSR +R PPP P Sbjct: 784 TKPATPRVPPNIPSRPPGARPTPPPPPP 811 >SB_38784| Best HMM Match : Apo-VLDL-II (HMM E-Value=8.3) Length = 439 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 145 LCPGVQEEIQKGPRYQQESSYAFAYCM 225 LCP ++ + GP +++E S AFA C+ Sbjct: 107 LCPLPEQNGEPGPMFEREGSDAFANCV 133 >SB_55740| Best HMM Match : C1_1 (HMM E-Value=3.6) Length = 533 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 145 LCPGVQEEIQKGPRYQQESSYAFAYCM 225 LCP ++ + GP +++E S AFA C+ Sbjct: 74 LCPLPEQNGEPGPMFEREGSDAFANCV 100 >SB_52369| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.18) Length = 308 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 6/54 (11%) Frame = -2 Query: 617 GCYIKQQQILHLLRLVTVQDSSLXSCTISYGL------VRVNNLLSSFPLKKSC 474 GC + +H+ V S SCT+S+G +R + + S PL + C Sbjct: 171 GCIVSHIDPMHIFDRPIVSCSFFSSCTLSFGCKFSFKPIRTTDPILSLPLPRGC 224 >SB_25455| Best HMM Match : DUF948 (HMM E-Value=0.11) Length = 260 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +1 Query: 274 IDSLFEGIDFYTSITRARFEELNAD--LFRSTMEPVEKSLRD 393 +DSL +DF T+ T A F +LN R T+ + SL + Sbjct: 168 LDSLAVRVDFTTNTTNALFTQLNTTDAAIRDTLSQINSSLSE 209 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,218,211 Number of Sequences: 59808 Number of extensions: 593774 Number of successful extensions: 4209 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 4008 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4202 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2251677692 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -