BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30857 (883 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF457554-1|AAL68784.1| 269|Anopheles gambiae salivary gland 1-l... 23 9.3 >AF457554-1|AAL68784.1| 269|Anopheles gambiae salivary gland 1-like 3 protein protein. Length = 269 Score = 23.4 bits (48), Expect = 9.3 Identities = 17/70 (24%), Positives = 29/70 (41%), Gaps = 3/70 (4%) Frame = +3 Query: 282 QQWGSNKLHRKIKIPNPFREIIMADPKIEEILAPLRANVKEQGD---LVRKLKEEKAPEI 452 QQW + L R + PN + + +L L + EQ + L+R E E Sbjct: 168 QQWSAEGLDRMVSFPNALPVGVQRVRALRALLETLLQHQGEQNNDVYLIRLAHETGRVEA 227 Query: 453 DIKKAVAELK 482 + +A A ++ Sbjct: 228 TVGQADAAVR 237 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 818,908 Number of Sequences: 2352 Number of extensions: 16706 Number of successful extensions: 20 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 94680279 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -