BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30856 (765 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 2.4 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 23 4.1 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 22 5.4 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 22 5.4 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 22 5.4 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 22 5.4 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 5.4 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 5.4 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.4 bits (48), Expect = 2.4 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -3 Query: 298 QAISRVKLTCLTTVYPSSRSLLMGEQS-NAWRMFXRNDRKSRHRR 167 + I V T YP++RSL + EQ+ +R +K R RR Sbjct: 117 ETIRPVFSTLQRAEYPTNRSLFIREQTEEMYREMLLEHKKRRARR 161 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 22.6 bits (46), Expect = 4.1 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = -2 Query: 701 PSTTPRPGNGSRLQTIPSPRHRTELYPDFGAVMHVLR 591 P T G S L TI SP LY D G V++ R Sbjct: 88 PDTYFYNGKHSYLHTITSPNKFVRLYQD-GRVLYSSR 123 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 22.2 bits (45), Expect = 5.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 360 ALGRAAGGAN*PSAGLCLNASKAEASL 440 ALGR AGG S+ L L+ + +SL Sbjct: 5 ALGRCAGGGGRLSSVLSLSLTSLASSL 31 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 22.2 bits (45), Expect = 5.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 360 ALGRAAGGAN*PSAGLCLNASKAEASL 440 ALGR AGG S+ L L+ + +SL Sbjct: 5 ALGRCAGGGGRLSSVLSLSLTSLASSL 31 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 22.2 bits (45), Expect = 5.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 360 ALGRAAGGAN*PSAGLCLNASKAEASL 440 ALGR AGG S+ L L+ + +SL Sbjct: 5 ALGRCAGGGGRLSSVLSLSLTSLASSL 31 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 22.2 bits (45), Expect = 5.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 360 ALGRAAGGAN*PSAGLCLNASKAEASL 440 ALGR AGG S+ L L+ + +SL Sbjct: 5 ALGRCAGGGGRLSSVLSLSLTSLASSL 31 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -2 Query: 386 RTTGRSAECMNQMSETAVPLVLSS 315 + G+ +C N MSE V ++L + Sbjct: 170 KENGKEFDCHNYMSELTVDILLET 193 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 22.2 bits (45), Expect = 5.4 Identities = 17/74 (22%), Positives = 31/74 (41%) Frame = -1 Query: 729 TDRSTDGCSTEHNTPARKRKSSTDYSEPPTSN*VISGLRSRDARVKKKTDSIDLRDPNGL 550 T+ C+T TP++ ++S YS T + + RS +V + Sbjct: 348 TETLNTKCNTLERTPSKCSQTSVHYSNGQTHSQLCPTPRSTHLKVS------GINRVGST 401 Query: 549 RRRVSRFECETRLV 508 RR R CE++++ Sbjct: 402 RRPSRRNSCESQMM 415 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,370 Number of Sequences: 438 Number of extensions: 4543 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23911269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -