BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30855 (876 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC27B12.05 |||WD repeat protein|Schizosaccharomyces pombe|chr ... 29 0.66 SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schi... 29 0.66 SPBC1198.02 |dea2||adenine deaminase Dea2|Schizosaccharomyces po... 29 0.66 SPAC824.05 |vps16||HOPS complex subunit Vps16 |Schizosaccharomyc... 27 3.5 SPAC30D11.06c |||DUF300 family protein|Schizosaccharomyces pombe... 26 8.1 >SPBC27B12.05 |||WD repeat protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 391 Score = 29.5 bits (63), Expect = 0.66 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +3 Query: 243 KGTIYDTLSQSHTKIVEENQHFKRSLAVTSTKIVGIKMNAKRNKL*H 383 K IYD + I+ + QH LAV+ +I+GI N+ L H Sbjct: 27 KVAIYDVQKLNREPIIYDVQHSAWGLAVSPLRILGISSNSHNVNLFH 73 >SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 3071 Score = 29.5 bits (63), Expect = 0.66 Identities = 11/37 (29%), Positives = 26/37 (70%) Frame = -2 Query: 572 YDLANALRQGALDSSSQFEERALSTRR*VRVLFDEGL 462 +D A+++ +GA ++++ F+ER + R R++ D+G+ Sbjct: 2912 FDFASSISEGARNTTTVFDERHIEKLRLSRLMSDDGV 2948 >SPBC1198.02 |dea2||adenine deaminase Dea2|Schizosaccharomyces pombe|chr 2|||Manual Length = 367 Score = 29.5 bits (63), Expect = 0.66 Identities = 19/67 (28%), Positives = 32/67 (47%) Frame = -2 Query: 650 PAYTSPHLNHSHFLILLNFHTAIERHYDLANALRQGALDSSSQFEERALSTRR*VRVLFD 471 PAY + ++F I +F+ ++ +ANA G+ S + EE S ++ V+ Sbjct: 292 PAYFGGYTLENYFAIQKHFNLTVKEWVFIANAAINGSWISGKRKEELLSSVQKCVKEYTA 351 Query: 470 EGLTPKT 450 E PKT Sbjct: 352 EIQQPKT 358 >SPAC824.05 |vps16||HOPS complex subunit Vps16 |Schizosaccharomyces pombe|chr 1|||Manual Length = 835 Score = 27.1 bits (57), Expect = 3.5 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 566 NHSAFR*QCENLKVLRNGSDSNVGLY 643 NH + C L+VL D NVG+Y Sbjct: 414 NHQEYVDVCRELRVLNAARDPNVGIY 439 >SPAC30D11.06c |||DUF300 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 426 Score = 25.8 bits (54), Expect = 8.1 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +3 Query: 168 HHHLDRSKLWPLSHI 212 H HL R +LWPL+++ Sbjct: 101 HGHLPRPRLWPLNYL 115 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,300,721 Number of Sequences: 5004 Number of extensions: 62710 Number of successful extensions: 121 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 121 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 438479610 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -