BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30855 (876 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0029 - 369791-370637,370704-371218 28 8.5 06_01_0347 + 2514831-2515068,2515126-2515304,2515514-2515747,251... 28 8.5 >10_01_0029 - 369791-370637,370704-371218 Length = 453 Score = 28.3 bits (60), Expect = 8.5 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = -1 Query: 321 LKTV*NADFLRQF*CATVRAYRRLSPSTVDNGQSLEQ 211 LK N D +RQF ATVR +RRL +D G L + Sbjct: 156 LKQDYNEDLIRQF-YATVRQFRRLLNIRLDFGDDLHE 191 >06_01_0347 + 2514831-2515068,2515126-2515304,2515514-2515747, 2515882-2516137,2516300-2516496 Length = 367 Score = 28.3 bits (60), Expect = 8.5 Identities = 18/45 (40%), Positives = 23/45 (51%) Frame = -2 Query: 650 PAYTSPHLNHSHFLILLNFHTAIERHYDLANALRQGALDSSSQFE 516 PAY SP + + LI NF +A +YD AL A+ S Q E Sbjct: 106 PAYLSPDASGKNLLIGANFASAGSGYYD-HTALLYHAIPLSQQLE 149 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,640,187 Number of Sequences: 37544 Number of extensions: 349142 Number of successful extensions: 656 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 656 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2467979640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -