BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30855 (876 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g45280.1 68415.m05636 DNA repair family protein contains simi... 29 4.1 At5g58350.1 68418.m07306 protein kinase family protein contains ... 28 9.4 At5g50160.1 68418.m06212 ferric reductase-like transmembrane com... 28 9.4 >At2g45280.1 68415.m05636 DNA repair family protein contains similarity to Swiss-Prot:O43502 DNA repair protein RAD51 homolog 3 [Homo sapiens] Length = 363 Score = 29.1 bits (62), Expect = 4.1 Identities = 20/76 (26%), Positives = 37/76 (48%) Frame = +1 Query: 79 IIYFRMCQEITLLSRINHLSIYKIFTSNVPIIILTVLNFGHCHTLF*TLAIVNSRRGQST 258 I YFR+C ++ +NHL + +V ++I+ + F H + LA +R + Sbjct: 212 IFYFRVCSYTEQIALVNHLEKFISENKDVKVVIVDSITF-HFRQDYDDLA----QRTRVL 266 Query: 259 IRSHSRTLKLSKKISI 306 + +KL+KK S+ Sbjct: 267 SEMALKFMKLAKKFSL 282 >At5g58350.1 68418.m07306 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 571 Score = 27.9 bits (59), Expect = 9.4 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +1 Query: 91 RMCQEITLLSRINHLSIYKIFTSNVPIIILTVLNF 195 R+ E+ LLS +NH SI + +TS + + T LNF Sbjct: 64 RLYSEVHLLSTLNHKSIIRFYTSWIDVHNHT-LNF 97 >At5g50160.1 68418.m06212 ferric reductase-like transmembrane component family protein contains Pfam profile PF01794: Ferric reductase like transmembrane component Length = 728 Score = 27.9 bits (59), Expect = 9.4 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = -3 Query: 286 ILVCDCESVS*IVPFYC*QWPKFRTMCDNGQSLERSR 176 +LVC ESV V C QWP+ C + L RSR Sbjct: 682 VLVCGPESVKEAVASMCRQWPQ----CFGVEDLRRSR 714 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,596,985 Number of Sequences: 28952 Number of extensions: 308796 Number of successful extensions: 628 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 628 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2058178400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -