BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30854 (828 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. 25 2.2 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 25 2.8 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 24 5.0 DQ080906-1|AAY89552.1| 120|Anopheles gambiae olfactory receptor... 23 8.7 DQ080904-1|AAY89550.1| 120|Anopheles gambiae olfactory receptor... 23 8.7 >AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. Length = 179 Score = 25.4 bits (53), Expect = 2.2 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 730 SLRMSRYNILGFLP*QPRSKKPLRLFG 650 S+R + +LGF P + SK+ RLFG Sbjct: 146 SIRQNIQKMLGFAPSRAASKQGRRLFG 172 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 25.0 bits (52), Expect = 2.8 Identities = 10/30 (33%), Positives = 21/30 (70%) Frame = -2 Query: 791 III*SHSNWSDETNFKSGVLIPPNVEIQYI 702 I++ ++++ + E +KS VLI PN E+ ++ Sbjct: 113 IVLFNNADGNYEVRYKSNVLIYPNGEVLWV 142 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 24.2 bits (50), Expect = 5.0 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = +1 Query: 379 FCNENYKHVSYPINMIVS*QKLDSFLCKIKIFL 477 FC ++YK+ ++P N+ ++ +K D+ KI+ L Sbjct: 806 FCFDDYKNQTFPFNLDIN-KKADNGSKKIEFRL 837 >DQ080906-1|AAY89552.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/29 (27%), Positives = 17/29 (58%) Frame = +1 Query: 637 WHVRLQIASRAF*IAVVMVKTLIYCISTF 723 W+V+++IA +A+ +V YC+ + Sbjct: 44 WYVKVRIAVNLITLAICIVGEFRYCLYAY 72 >DQ080904-1|AAY89550.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/29 (27%), Positives = 17/29 (58%) Frame = +1 Query: 637 WHVRLQIASRAF*IAVVMVKTLIYCISTF 723 W+V+++IA +A+ +V YC+ + Sbjct: 44 WYVKVRIAVNLITLAICIVGEFRYCLYAY 72 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 791,057 Number of Sequences: 2352 Number of extensions: 14036 Number of successful extensions: 70 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 88150236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -