BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30853 (835 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 24 6.6 AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CY... 23 8.7 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 23.8 bits (49), Expect = 6.6 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = -3 Query: 779 FSCKSQSPSAELKLQFSAHQVKCQQALSSSTGIVC 675 F C S KLQ+ H+ + + + + GI C Sbjct: 349 FQCNLCDMSYRTKLQYQKHEYEVHRISNENFGIKC 383 >AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CYP4H24 protein. Length = 193 Score = 23.4 bits (48), Expect = 8.7 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 494 TVAEIRKKKNLVLLMQKVLPTQLPSFP 574 T+ EIR K +LVL K +P +L + P Sbjct: 167 TMHEIRLKTDLVLRPDKSIPIKLVARP 193 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 745,908 Number of Sequences: 2352 Number of extensions: 13743 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88065063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -