BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30853 (835 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g26200.1 68418.m03118 mitochondrial substrate carrier family ... 34 0.13 At3g49990.1 68416.m05466 expressed protein 33 0.23 At1g62480.1 68414.m07050 vacuolar calcium-binding protein-relate... 33 0.23 At5g22810.1 68418.m02667 GDSL-motif lipase, putative similar to ... 30 2.2 At3g01290.1 68416.m00037 band 7 family protein similar to hypers... 29 3.8 At5g09530.1 68418.m01103 hydroxyproline-rich glycoprotein family... 29 5.0 At2g45800.1 68415.m05696 LIM domain-containing protein similar t... 29 5.0 >At5g26200.1 68418.m03118 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 342 Score = 33.9 bits (74), Expect = 0.13 Identities = 18/39 (46%), Positives = 27/39 (69%) Frame = -1 Query: 229 TSVGLTESSILGATSRIG*AGTTSFSSATGIAKLTAAKA 113 T++ +T+SS+ AT R+G + TTS + A G A LT+A A Sbjct: 108 TALEITKSSVGQATVRLGLSDTTSLAVANGAAGLTSAVA 146 >At3g49990.1 68416.m05466 expressed protein Length = 502 Score = 33.1 bits (72), Expect = 0.23 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 407 IPDAEAKSADIKVEEPAAQPEDSKTEVQATVAEIRKKKNLV 529 +P A+ D+K E P A+P KT Q + E +++KN V Sbjct: 422 LPGRRAEQTDVKAEIPKAEPIKRKTHGQESKEEKKERKNAV 462 >At1g62480.1 68414.m07050 vacuolar calcium-binding protein-related contains weak similarity to vacuolar calcium binding protein [Raphanus sativus] gi|9049359|dbj|BAA99394 Length = 152 Score = 33.1 bits (72), Expect = 0.23 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 1/85 (1%) Frame = +2 Query: 248 EETEPAPVSNDEVPAIPEAKKDDIAPEDSDIAXXXXXXXXXXXXXXXXAKSSEIPDAEAK 427 EETE A V E P + E KKD+ AP ++ + K E+ + + + Sbjct: 65 EETEEAQV---ETPEVVEIKKDEEAPVETPVV---VEDESKTEEVVEAKKEEEVEEKKTE 118 Query: 428 SADIKV-EEPAAQPEDSKTEVQATV 499 A + V EE + E+ K V+A+V Sbjct: 119 EAPVVVEEEKKPEAEEEKPAVEASV 143 >At5g22810.1 68418.m02667 GDSL-motif lipase, putative similar to EXL3 (GP:15054386) [Arabidopsis thaliana] Length = 337 Score = 29.9 bits (64), Expect = 2.2 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = -1 Query: 316 IVLFGLWYSGYLVVTNWSRFGFFSSVAAATSVGLTESSILGATSRIG 176 +V+F ++ Y + T S FGF + A GL E+SIL +G Sbjct: 254 LVVFDIYQPLYDLATRPSEFGFAEARRACCGTGLLETSILCNPKSVG 300 >At3g01290.1 68416.m00037 band 7 family protein similar to hypersensitive-induced response protein [Zea mays] GI:7716470; contains Pfam profile PF01145: SPFH domain / Band 7 family Length = 285 Score = 29.1 bits (62), Expect = 3.8 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -3 Query: 227 FGRFNRVINFGRDF*NWLSGNYV 159 FG+F +V+N G F W+ G+YV Sbjct: 21 FGKFQKVLNPGLQFVPWVIGDYV 43 >At5g09530.1 68418.m01103 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 370 Score = 28.7 bits (61), Expect = 5.0 Identities = 36/116 (31%), Positives = 48/116 (41%), Gaps = 3/116 (2%) Frame = +2 Query: 395 KSSEIPDAEA-KSADIKVEEPAAQPEDSKT-EVQATVAEIRKKKNLVLL-MQKVLPTQLP 565 K E+P EA K +I+ E PE K E+Q E+ K + L KV Q P Sbjct: 201 KLPEVPKLEAPKVPEIQKPELPKMPELPKMPEIQKP--ELPKLPEVPKLEAPKVPEIQKP 258 Query: 566 SFPTW*RRSTWLLL*KAMLLQFPEIKTPEAADAPKVSRQFL*MRTKPADISPDAPK 733 P + K L + PEI+ PE P+V + L T P +APK Sbjct: 259 ELPKMPELPKMPEIQKPELPKMPEIQKPELPKVPEVPKPEL--PTVPEVPKSEAPK 312 >At2g45800.1 68415.m05696 LIM domain-containing protein similar to PGPS/D1 [Petunia x hybrida] GI:4105772, LIM domain protein PLIM1 [Nicotiana tabacum] GI:5932418; contains Pfam profile PF00412: LIM domain Length = 226 Score = 28.7 bits (61), Expect = 5.0 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +2 Query: 278 DEVPAIPEAKKDDIAPE 328 D+ +IPEAK+DD APE Sbjct: 197 DDTASIPEAKEDDAAPE 213 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,996,779 Number of Sequences: 28952 Number of extensions: 300742 Number of successful extensions: 873 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 846 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 873 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1921616800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -