BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30849 (657 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 26 0.28 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 24 1.1 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 1.9 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 22 4.5 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 22 4.5 S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor prot... 22 5.9 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 21 7.8 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 21 7.8 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 26.2 bits (55), Expect = 0.28 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +3 Query: 186 LQRFGIPAFLPWSSKVHEFRTCGPMVWEGLNVV 284 L G P + S+ V F+ GP W G+ VV Sbjct: 537 LSLLGGPLVMVCSAPVWRFQPWGPFTWGGIGVV 569 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 24.2 bits (50), Expect = 1.1 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -2 Query: 578 RFFYENVSFNHRMFNINYENKTK 510 ++ Y N ++N+ +N NY N K Sbjct: 330 KYNYNNNNYNNNNYNNNYNNNCK 352 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.4 bits (48), Expect = 1.9 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 7/44 (15%) Frame = +3 Query: 396 SVESAKKEIGLW-------FTDKEVVGWTPANENWVYE*IYFNL 506 +VE+AK +W TD+ WT NE +V +Y NL Sbjct: 1082 NVETAKTNEEMWELIDTEKLTDRLPYPWTMDNERYVKVDMYMNL 1125 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -2 Query: 563 NVSFNHRMFNINYENKTKLQIKINLLIN 480 N ++N+ + NY N K N +IN Sbjct: 321 NYNYNNNNYKYNYNNYNKKLYYKNYIIN 348 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 81 YTIRLNHNKSTLTLFRHHEILLTCSI 4 Y + + +K T T+ +H I L CS+ Sbjct: 61 YPLPYSGSKCTWTITSYHRINLKCSL 86 >S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor protein. Length = 169 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -2 Query: 644 IGGAIGVLGPPFRVFSYIML 585 + GA+GV P + SYI + Sbjct: 82 VAGAVGVFSSPTILISYIYI 101 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.4 bits (43), Expect = 7.8 Identities = 6/19 (31%), Positives = 14/19 (73%) Frame = -3 Query: 439 SVNQRPISFLADSTLSEPW 383 S+N+ ++++AD L++ W Sbjct: 43 SINEESMTYVADIFLAQSW 61 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 21.4 bits (43), Expect = 7.8 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = -1 Query: 48 LTLFRHHEILLTCSIN 1 L + +HH + CS+N Sbjct: 123 LQMTKHHNFIKVCSVN 138 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,285 Number of Sequences: 438 Number of extensions: 4515 Number of successful extensions: 11 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -