BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30847 (815 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0232 + 6614784-6614882,6616145-6616477,6616708-6616967,661... 30 2.5 >03_02_0232 + 6614784-6614882,6616145-6616477,6616708-6616967, 6617328-6617469,6617567-6617938,6618056-6618187, 6618907-6619035,6619125-6621188 Length = 1176 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 197 Y*TVCVRSKVLVLQTCIFHKVVVGITFIMV 108 Y +CV++ L Q+C+ H++VVG F+ + Sbjct: 353 YTELCVKAHALKGQSCVHHRLVVGNGFVTI 382 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,151,182 Number of Sequences: 37544 Number of extensions: 382979 Number of successful extensions: 662 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 642 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 662 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2232933960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -