BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30846 (895 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC20H4.09 |||ATP-dependent RNA helicase, spliceosomal |Schizos... 29 0.89 SPCC663.03 |pmd1||leptomycin efflux transporter Pmd1|Schizosacch... 26 6.3 >SPAC20H4.09 |||ATP-dependent RNA helicase, spliceosomal |Schizosaccharomyces pombe|chr 1|||Manual Length = 647 Score = 29.1 bits (62), Expect = 0.89 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = -2 Query: 450 SSRRYRGRVSRLYTEQAPSLPPQQF 376 + R RG+V RLYTE+A SL ++F Sbjct: 354 AGRTMRGKVFRLYTEKAYSLMKEEF 378 >SPCC663.03 |pmd1||leptomycin efflux transporter Pmd1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1362 Score = 26.2 bits (55), Expect = 6.3 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = +1 Query: 10 GDHNEV---HGYFGGIVGRGCLCQGGERHTEAVEEKKQDKRGIYDIGSYG 150 G HNE+ +G + +V L GGE+ E VEE+ +D I S+G Sbjct: 647 GSHNELLDLNGAYARLVEAQKL-SGGEKDQEMVEEELEDAPREIPITSFG 695 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,064,034 Number of Sequences: 5004 Number of extensions: 57357 Number of successful extensions: 158 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 158 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 450492750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -