BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30846 (895 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical prot... 29 0.25 DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. 26 1.3 DQ518577-1|ABF66619.1| 318|Anopheles gambiae putative secreted ... 25 2.3 DQ370043-1|ABD18604.1| 161|Anopheles gambiae putative TIL domai... 23 9.5 >AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical protein protein. Length = 278 Score = 28.7 bits (61), Expect = 0.25 Identities = 19/46 (41%), Positives = 24/46 (52%) Frame = +1 Query: 637 PLPYTVEKKIPL*SESARFPSPTLFEKKGPSFQ*NYELKVPQPYEV 774 P+PYTVEK P+ E P P KK +E+ VP+PY V Sbjct: 223 PVPYTVEKPYPIEVEK---PFPVEVLKK-------FEVPVPKPYPV 258 Score = 25.8 bits (54), Expect = 1.8 Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +2 Query: 578 VPYEVKVHVDKPYEVKVQ-SAHFLTPLRRKFPYEVKVPV 691 VP+ VKV++ +PY ++V P+ + P ++ PV Sbjct: 186 VPHYVKVYIPQPYPLQVNVEQPIKIPIYKVIPKVIEKPV 224 >DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. Length = 494 Score = 26.2 bits (55), Expect = 1.3 Identities = 16/62 (25%), Positives = 30/62 (48%) Frame = -2 Query: 267 SCSFPSEIVSFLVTEADTFVPSIAFVTAVAFIATSEIMSSIRSYVIDAPFVLFLLFDCFG 88 S + P V+ ++ + D + A A A + + S R + +APF+++L D G Sbjct: 423 SSAGPKPYVNQILHKLDLTIDEEGTEGAAATSALVDRIGSQRQFNGNAPFLIYLRHDATG 482 Query: 87 VP 82 +P Sbjct: 483 LP 484 >DQ518577-1|ABF66619.1| 318|Anopheles gambiae putative secreted carbonic anhydrase protein. Length = 318 Score = 25.4 bits (53), Expect = 2.3 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 368 AHQNC*GGKEGACSVYSRETRPLY 439 AHQ+C G + +++S PLY Sbjct: 48 AHQSCAGAHQSPIAIHSHRAVPLY 71 >DQ370043-1|ABD18604.1| 161|Anopheles gambiae putative TIL domain polypeptide protein. Length = 161 Score = 23.4 bits (48), Expect = 9.5 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +2 Query: 626 VQSAHFLTPLRRKFPYEVKVPVSPALHC 709 +Q+AH P +PY++ P L C Sbjct: 17 LQNAHCACPYAHPYPYDLCGPNEELLEC 44 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 786,866 Number of Sequences: 2352 Number of extensions: 14732 Number of successful extensions: 31 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 96334083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -