BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30845 (690 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF000196-2|AAC24253.1| 345|Caenorhabditis elegans Ribosomal pro... 83 1e-16 AF125463-2|AAD12867.2| 167|Caenorhabditis elegans Hypothetical ... 30 1.8 >AF000196-2|AAC24253.1| 345|Caenorhabditis elegans Ribosomal protein, large subunitprotein 4 protein. Length = 345 Score = 83.4 bits (197), Expect = 1e-16 Identities = 38/85 (44%), Positives = 55/85 (64%), Gaps = 1/85 (1%) Frame = +2 Query: 2 FNKDQGLTRAFRNIPGVEXXXXXXXXXXXXAPGGHLGRFVIWTQSAFGRLDPLFGSWKTP 181 + +D RAFRNIPGV+ APGGHLGR +IWT+SAF +LD ++G+ Sbjct: 210 YGQDAECARAFRNIPGVDVMNVERLNLLKLAPGGHLGRLIIWTESAFKKLDTIYGTTVAN 269 Query: 182 SKQ-KKNFNLPQPKMANTDLTRLLK 253 S Q KK +++P P MAN+D +R+++ Sbjct: 270 SSQLKKGWSVPLPIMANSDFSRIIR 294 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/50 (32%), Positives = 29/50 (58%) Frame = +1 Query: 256 DEIRKVLRAPNKRVIRATRKLNPLTNNKAMLKLNPYAAVLKRKAILELRR 405 +E+ K +RAP K + NPL + KLNPYA++L++ + +++ Sbjct: 296 EEVVKAIRAPKKNPVLPKVHRNPLKKRTLLYKLNPYASILRKASKANVKK 345 >AF125463-2|AAD12867.2| 167|Caenorhabditis elegans Hypothetical protein Y49F6C.7 protein. Length = 167 Score = 29.9 bits (64), Expect = 1.8 Identities = 21/76 (27%), Positives = 33/76 (43%) Frame = +1 Query: 172 EDTIKTKEELQPAPTEDGQH*PHTSSQVDEIRKVLRAPNKRVIRATRKLNPLTNNKAMLK 351 E+ +E QPA T + Q+D R+ +RA + R R L + N + Sbjct: 5 EEHQNLEENYQPARTPRNELVAQIQVQLDINRQEIRAREREQARLLRDLREMDNRIRIEM 64 Query: 352 LNPYAAVLKRKAILEL 399 +N A VL+ +L L Sbjct: 65 MNLRARVLEENPLLAL 80 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,999,829 Number of Sequences: 27780 Number of extensions: 256826 Number of successful extensions: 703 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 702 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1581836700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -