BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30841 (662 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0442 - 15967204-15967501,15967954-15968126,15968581-159687... 30 1.4 01_06_0380 - 28874699-28874732,28875077-28876116 29 3.3 01_06_0782 + 31969677-31969767,31969863-31969960,31970059-319702... 29 4.4 >04_03_0442 - 15967204-15967501,15967954-15968126,15968581-15968716, 15969064-15969288,15969792-15970053,15970062-15970169, 15970337-15970595,15971188-15971199 Length = 490 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = -3 Query: 141 HFFIHCPLSRTDFARNHLESNRWCFSRTGWFPDSVSYS 28 H FIH FARNHLES W G D V ++ Sbjct: 122 HLFIHEFEETISFARNHLESMIWDSVLKGPLADQVKHA 159 >01_06_0380 - 28874699-28874732,28875077-28876116 Length = 357 Score = 29.1 bits (62), Expect = 3.3 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = +1 Query: 43 IRKPASAAKTPSVTFQVIPSEISPTQWAVYEEMEDLPEGISYKMPIIKGDPQHSQK 210 ++ + AK SV FQ I S A+ EE+EDL + + + K D + S + Sbjct: 207 LKDTSDKAKQNSVVFQYIASSSDAKVLALREELEDLQKLLQAEKDEFKADKRDSNQ 262 >01_06_0782 + 31969677-31969767,31969863-31969960,31970059-31970235, 31970367-31970467,31970626-31970701,31970827-31970886, 31970979-31971215,31971612-31971686,31971981-31972039, 31972110-31972201,31972463-31972623,31972964-31973176 Length = 479 Score = 28.7 bits (61), Expect = 4.4 Identities = 22/58 (37%), Positives = 31/58 (53%) Frame = -1 Query: 191 SPLIIGILYDIPSGKSSISSYTAH*VGLISLGITWKVTDGVLAALAGFLILFRTLSGL 18 +PL IGIL D G + S+ + VGL LG T + V+ AGF+I F L+ + Sbjct: 303 NPLGIGILLDGLFGTGTGSTVSVENVGL--LGSTRIGSRRVIQISAGFMIFFSMLAAV 358 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,927,491 Number of Sequences: 37544 Number of extensions: 273080 Number of successful extensions: 658 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 647 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 658 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1667659452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -