BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30839 (572 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 25 0.46 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 24 1.1 AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 21 5.6 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 5.6 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 21 5.6 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 25.0 bits (52), Expect = 0.46 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = -3 Query: 399 EEVRQLLQQHVFVANCRSTLQVLLVELPRKRPQLAWLLKHSHKFR 265 EE++ LLQ++ +ANC+ LV+ P+ ++ + H R Sbjct: 35 EEIKDLLQKYPPIANCK------LVQAPKLNAEVKRAITQQHSER 73 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 23.8 bits (49), Expect = 1.1 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 558 PGTRRGFYNNKINY 517 PG R G YN+K NY Sbjct: 144 PGQRGGAYNDKSNY 157 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 21.4 bits (43), Expect = 5.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 19 EVVQFRALVTPCMPTCE 69 EVV+ LV C TCE Sbjct: 299 EVVEIYLLVYACASTCE 315 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 5.6 Identities = 5/41 (12%), Positives = 22/41 (53%) Frame = -3 Query: 264 RSLYIYCILCDILSTLFVESEFISNLDGLHEKHIICRCSRC 142 ++++ C++ + +++ ++ + L+ +++C C C Sbjct: 889 QTIFALCVVLQLQENDWLQLGYLIFVSTLYTANVVCICHVC 929 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 21.4 bits (43), Expect = 5.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 19 EVVQFRALVTPCMPTCE 69 EVV+ LV C TCE Sbjct: 299 EVVEIYLLVYACASTCE 315 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,287 Number of Sequences: 336 Number of extensions: 2572 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14203976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -