BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30839 (572 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_03_0125 + 15529391-15529495,15530066-15530226,15530315-155305... 28 6.1 >02_03_0125 + 15529391-15529495,15530066-15530226,15530315-15530570, 15531360-15531374,15533608-15533967 Length = 298 Score = 27.9 bits (59), Expect = 6.1 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +1 Query: 43 VTPCMPTCEPVQC-DGGPNELRSVMSYGRRKRRSTSATPTDDMLL 174 V C C PV C GP+ R V+ G R+RR + + D+ L Sbjct: 74 VATCREDCPPVHCRPHGPDLRRGVV--GERRRRCSKSVALRDLRL 116 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,240,617 Number of Sequences: 37544 Number of extensions: 291055 Number of successful extensions: 801 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 785 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 801 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1328870592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -