BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30838 (706 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000DB7E6F Cluster: PREDICTED: hypothetical protein;... 82 1e-14 UniRef50_Q8PYI0 Cluster: Conserved protein; n=1; Methanosarcina ... 34 3.9 UniRef50_A7T1W3 Cluster: Predicted protein; n=2; Nematostella ve... 33 9.0 >UniRef50_UPI0000DB7E6F Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 218 Score = 82.2 bits (194), Expect = 1e-14 Identities = 43/71 (60%), Positives = 54/71 (76%), Gaps = 7/71 (9%) Frame = +1 Query: 1 RHLSMKKTIRKKIMRDLQQAFVEDPNEFKVENTSPEKLKAELSAEAVKI----EKNVR-- 162 RHLSMKKTIRKKIMRDLQQAFVEDPNEF+V++ PE+LKAE++ +++ +K R Sbjct: 81 RHLSMKKTIRKKIMRDLQQAFVEDPNEFRVDDIPPEQLKAEINIQSLSFGTPSQKQGRTR 140 Query: 163 -KNDPTFLDML 192 + TFLDML Sbjct: 141 GNTENTFLDML 151 >UniRef50_Q8PYI0 Cluster: Conserved protein; n=1; Methanosarcina mazei|Rep: Conserved protein - Methanosarcina mazei (Methanosarcina frisia) Length = 310 Score = 33.9 bits (74), Expect = 3.9 Identities = 16/52 (30%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +1 Query: 13 MKKTIRKKIMRDLQQAFVEDPNEFKVENTSPEKLKAELSAEA-VKIEKNVRK 165 +KK ++K+ DLQ + P++FKVE+ P K+ E+ + ++ +K+ R+ Sbjct: 79 LKKEDKEKLKADLQDIWERYPDDFKVEDNEPLKVINEIMTKRFIQTQKSARE 130 >UniRef50_A7T1W3 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 719 Score = 32.7 bits (71), Expect = 9.0 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -2 Query: 531 LICDRKTDYERATWCA*CEFLNVLDSVKVNPILY 430 +I K DYE T C FL++L + +NP++Y Sbjct: 259 IIFQLKLDYEHDTLARYCTFLSLLSNALINPVIY 292 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 595,424,726 Number of Sequences: 1657284 Number of extensions: 10442632 Number of successful extensions: 27850 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 27068 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27834 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 56198352344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -