BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30838 (706 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3H8.04 |||chromosome segregation protein|Schizosaccharomyces... 27 2.6 SPBC1703.14c |top1||DNA topoisomerase I|Schizosaccharomyces pomb... 27 2.6 SPBC16A3.08c |||nuclear telomere cap complex subunit |Schizosacc... 27 3.5 SPAC9E9.12c |ybt1|abc1|ABC transporter Ybt1|Schizosaccharomyces ... 26 4.6 SPAC22E12.19 ||SPAC2E12.01|histone deacetylase complex subunit |... 26 6.0 SPCC584.05 |sec1||SNARE binding protein Sec1|Schizosaccharomyces... 25 8.0 >SPAC3H8.04 |||chromosome segregation protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 338 Score = 27.1 bits (57), Expect = 2.6 Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 9/52 (17%) Frame = +1 Query: 433 QNWVNFYAIENVKKLALSTPGRS-----FIIRFPIAYQLF----IIKPFNNP 561 Q W+N +I +K + PG S F+ P+ +++F +KP N P Sbjct: 36 QEWMNLKSISQMKDFFSNFPGNSKANNHFLCNSPLKFEIFNNEKSVKPSNGP 87 >SPBC1703.14c |top1||DNA topoisomerase I|Schizosaccharomyces pombe|chr 2|||Manual Length = 814 Score = 27.1 bits (57), Expect = 2.6 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 16 KKTIRKKIMRDLQQAFVEDPNEFKVENTSPEKLK-AELSAEAVKIEKNVRKNDP 174 K+ I+KK R+ ++ EDP E+ +LK A+ +A+ E +K DP Sbjct: 676 KEKIKKKFDRENEKLAAEDPKSVLPESELEVRLKAADELKKALDAELKSKKVDP 729 >SPBC16A3.08c |||nuclear telomere cap complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 284 Score = 26.6 bits (56), Expect = 3.5 Identities = 16/57 (28%), Positives = 31/57 (54%) Frame = +1 Query: 4 HLSMKKTIRKKIMRDLQQAFVEDPNEFKVENTSPEKLKAELSAEAVKIEKNVRKNDP 174 +LS +K+ K + R +++ N KVE ++PE+L A L A + + +++ P Sbjct: 180 YLSERKSAAKPVGRTVEKL----ENATKVEKSAPEELFASLKKSASQKKSAAKESKP 232 >SPAC9E9.12c |ybt1|abc1|ABC transporter Ybt1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1427 Score = 26.2 bits (55), Expect = 4.6 Identities = 15/69 (21%), Positives = 29/69 (42%) Frame = +1 Query: 361 VSSYLYGMGSFA*VCR*GRYSNCIQNWVNFYAIENVKKLALSTPGRSFIIRFPIAYQLFI 540 +SS YG F+ + + + ++ Y + S G SF++ P+AY + + Sbjct: 106 LSSLKYGSTLFSWISVANAFGLLLLRLISIYDFLTYSSWSFSVKGGSFLLLLPLAYNITL 165 Query: 541 IKPFNNPLY 567 PL+ Sbjct: 166 FLLVIIPLF 174 >SPAC22E12.19 ||SPAC2E12.01|histone deacetylase complex subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 661 Score = 25.8 bits (54), Expect = 6.0 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +1 Query: 67 EDPNEFKVENTSPEKLKAELSAE-AVKIEKNVRKNDPTFLDM 189 E+ N + EK+K+ + A +IEK ++ DP +DM Sbjct: 379 ENVNNHNADEQMDEKIKSLVEGNSAYEIEKGAQEPDPMSIDM 420 >SPCC584.05 |sec1||SNARE binding protein Sec1|Schizosaccharomyces pombe|chr 3|||Manual Length = 693 Score = 25.4 bits (53), Expect = 8.0 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 22 TIRKKIMRDLQQAFVEDPNEFKVENT 99 TIR MRD + ++D N+F ++NT Sbjct: 289 TIRHMHMRDAIEKLMKDFNQFCIDNT 314 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,536,192 Number of Sequences: 5004 Number of extensions: 46689 Number of successful extensions: 126 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 126 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -