BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30837 (706 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF067222-1|AAC17017.2| 1464|Caenorhabditis elegans Hypothetical ... 29 2.4 Z69636-1|CAA93465.2| 1180|Caenorhabditis elegans Hypothetical pr... 28 7.5 >AF067222-1|AAC17017.2| 1464|Caenorhabditis elegans Hypothetical protein H11E01.3 protein. Length = 1464 Score = 29.5 bits (63), Expect = 2.4 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +1 Query: 412 RETLFFTSVRAVPSTTKRKEGNTLKIATQSVINFSG 519 ++ +F R++PS T GNTLK +SV+N G Sbjct: 153 QQASWFFRRRSLPSLTASAPGNTLKEPLRSVLNMRG 188 >Z69636-1|CAA93465.2| 1180|Caenorhabditis elegans Hypothetical protein F20B10.1 protein. Length = 1180 Score = 27.9 bits (59), Expect = 7.5 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 226 RANFTGCT*HSPDVPYLIQSWVMTPDNKKSA 318 + + G H+ D+P+ + WV T NK+ A Sbjct: 472 KEGYKGKNCHTTDLPHSCEEWVFTKGNKQKA 502 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,089,500 Number of Sequences: 27780 Number of extensions: 407716 Number of successful extensions: 882 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 855 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 882 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1634564590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -