BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30829 (810 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 pro... 60 6e-11 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 26 1.6 EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. 24 4.8 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 24 4.8 EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. 24 4.8 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 24 4.8 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 24 4.8 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 24 4.8 EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. 24 4.8 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 24 4.8 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 24 4.8 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 24 4.8 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 24 4.8 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 24 4.8 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 24 4.8 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 24 4.8 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 24 4.8 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 24 4.8 EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. 24 4.8 EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. 24 4.8 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 24 4.8 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 24 4.8 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 24 4.8 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 24 4.8 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 24 4.8 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 24 4.8 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 24 4.8 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 24 4.8 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 24 4.8 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 24 4.8 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 24 4.8 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 24 4.8 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 24 4.8 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 24 4.8 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 24 4.8 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 24 4.8 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 24 4.8 AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. 24 4.8 AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. 24 4.8 AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. 24 4.8 AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. 24 4.8 AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. 24 4.8 AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. 24 4.8 AF316636-1|AAG45164.1| 221|Anopheles gambiae glutathione S-tran... 24 4.8 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 24 6.4 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 23 8.4 >AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 protein protein. Length = 160 Score = 60.5 bits (140), Expect = 6e-11 Identities = 31/88 (35%), Positives = 51/88 (57%), Gaps = 3/88 (3%) Frame = +2 Query: 257 LPIYQAISKARSADTANDFIEGLRHFDKDGNGFISSAELRHLLSTLGEKLSDDEVEQLLQ 436 LPI+ + K + DF+E L+ +DK+ +G + AEL H L+ LGE+L D E++ +++ Sbjct: 69 LPIFSQVKKEKEQGCFEDFLECLKLYDKNEDGTMLLAELTHSLTALGERLDDVELDNVMK 128 Query: 437 ---GQEDSQGNINYENFVHLIMQG*VLV 511 ED GNI Y F+ +M V++ Sbjct: 129 DCMDPEDDDGNIPYAPFLKKMMDNMVVI 156 Score = 38.3 bits (85), Expect = 3e-04 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 1/96 (1%) Frame = +3 Query: 81 QLAEFQEAFQLFDSRGDGKIHVAQIGDALRALGQNPT-ESDVKKCTLHLKPDERISFEVF 257 ++ + Q F ++D G G++ +G+ALRAL NPT E K + +++I FE F Sbjct: 9 EIEKAQFVFSVYDWEGSGQMDAMDLGNALRALNLNPTIELIGKMGGTQKRGEKKIKFEEF 68 Query: 258 CQFTRPYRKHAVPTLLMTLLRVCAILTKMAMGSSLL 365 +K L + K G+ LL Sbjct: 69 LPIFSQVKKEKEQGCFEDFLECLKLYDKNEDGTMLL 104 Score = 27.5 bits (58), Expect = 0.52 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +3 Query: 90 EFQEAFQLFDSRGDGKIHVAQIGDALRALGQ 182 +F E +L+D DG + +A++ +L ALG+ Sbjct: 86 DFLECLKLYDKNEDGTMLLAELTHSLTALGE 116 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 25.8 bits (54), Expect = 1.6 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 Query: 358 DEPIAIFVKMAQTLNKVISSVGTACF 281 D IA F+KM Q VI GTA F Sbjct: 540 DRAIAAFMKMPQFFQNVIFYFGTASF 565 >EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 242 FSQNLEHFDLRGNGF 256 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. Length = 496 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 311 FIEGLRHFDKDGNGF 355 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AF316636-1|AAG45164.1| 221|Anopheles gambiae glutathione S-transferase E2 protein. Length = 221 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -1 Query: 84 IDPLNIQPYYESTNEIEGNEIGIF 13 ID L PYYE N G ++G F Sbjct: 187 IDRLKQLPYYEEANGGGGTDLGKF 210 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 23.8 bits (49), Expect = 6.4 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +2 Query: 263 IYQAISKARSADTANDFIEGLRHFDKDGNGFISSAE 370 + + + + R ADTA + H DK+ F+ A+ Sbjct: 473 VEKEVRERREADTAAELRYAKEHADKENRHFLQYAQ 508 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 23.4 bits (48), Expect = 8.4 Identities = 13/46 (28%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +3 Query: 273 PYRKHAVPTLLMTLLRVCAILTKMAMGSSLLRNCDTCSL--LSERS 404 P ++ LL+ L +IL + ++NC +CS+ +S+RS Sbjct: 313 PAQQDRFNVLLLILFLCVSILGTLITPELWMKNCKSCSISPVSDRS 358 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 809,317 Number of Sequences: 2352 Number of extensions: 15265 Number of successful extensions: 82 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 85655418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -